SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002104 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002104
Domain Number 1 Region: 129-371
Classification Level Classification E-value
Superfamily vWA-like 3.11e-85
Family Integrin A (or I) domain 0.000000234
Further Details:      
 
Domain Number 2 Region: 348-460
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-19
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 3 Region: 630-718
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.09e-18
Family Integrin beta tail domain 0.0027
Further Details:      
 
Domain Number 4 Region: 16-74
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000035
Family Plexin repeat 0.0014
Further Details:      
 
Domain Number 5 Region: 588-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000893
Family Integrin beta EGF-like domains 0.0023
Further Details:      
 
Domain Number 6 Region: 546-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002104   Gene: ENSGACG00000001584   Transcript: ENSGACT00000002108
Sequence length 780
Comment pep:known_by_projection scaffold:BROADS1:scaffold_169:117112:123468:1 gene:ENSGACG00000001584 transcript:ENSGACT00000002108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CHFGSQEFVASLSEGSICIKANAQSCGECIQVAETCGWCADETFLTVGESKSARCDDLES
LKKRGCSLTKIENPRGGIRIDQNKTVTNRKKDVAEKLTPEQITQIQPQKLSLTLRSGEPQ
TFELKFKRAEDYPIDLYYLMDLSFSMKDDLENVKNLGTDLMREMQGITSDFRIGFGSFVE
KTVMPYISTTPARLINPCTGNQNCTSPFSYKNVLKLTDKGDEFNRLVSQQQISGNLDSPE
GGFDAIMQVAVCENQIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGRCHLENNMYT
MSHYYDYPSIAHLVQKLSDHNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSSNSSNVIK
LIIDAYNSLSSEVILENSRLPEGVSITYKSICKNGVEGTGENGRKCSNISIGDEVLFHIS
IESQKCPSHGKPEVIKIKPLGFTEEVEVVLTFICDCPCAKNGVTNSDQCSEGNGTFECGA
CKCNDGRIGRLCECSKDEVRTEDLDANCRKDNGTDICSNNGDCVCGTCECKKRENPAEIY
SGKYCECDNFNCDRSNNKLCGGHGRCDCRKCICDANYTGSACDCSLETATCLAKNGQICN
GRGTCECGACKCTNPKFQGPTCEICPTCPGVCPEHKDCVQCRAFEAGEKKDTCERDCSYF
QLMKVKDRDKLPQPADQSYPLSHCKERDANDCWFYYTYAIRNDTKEVYVVETLECPAGPD
IIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQRNPIYKSPIN
Download sequence
Identical sequences G3N9W2
ENSGACP00000002104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]