SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002228 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002228
Domain Number 1 Region: 141-383
Classification Level Classification E-value
Superfamily vWA-like 4.22e-83
Family Integrin A (or I) domain 0.000000259
Further Details:      
 
Domain Number 2 Region: 642-731
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.96e-20
Family Integrin beta tail domain 0.0023
Further Details:      
 
Domain Number 3 Region: 362-472
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-20
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 4 Region: 29-87
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000011
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 599-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family Integrin beta EGF-like domains 0.003
Further Details:      
 
Domain Number 6 Region: 558-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Integrin beta EGF-like domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002228   Gene: ENSGACG00000001700   Transcript: ENSGACT00000002234
Sequence length 803
Comment pep:known_by_projection group:BROADS1:groupXXI:795606:806190:-1 gene:ENSGACG00000001700 transcript:ENSGACT00000002234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRTDLQSVGWSAILVQTFSCGDAQKEGNECINANAKYCGECIQAGAKCGWCKDPNFLKQ
GETVSTRCDEMHSLIKRGCDDDMIENPHGKQKILKNKKVTHRKKGAEKLKPEEITQIQPQ
KLSLTLRSGEPQSFNLTFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTSLMLEMSKIT
SDFRIGFGSFVEKTVMPYISTTPAKLLNPCTGDQNCTSPFSYKNVLKLTSDGKKFNNLVG
QQHISGNLDSPEGGFDAIMQVAVCGDHIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPN
DGKCHLENNAYTMSHYYDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYQELKNLIPKSAV
GTLSANSSNVINLIIDAYNSLSSEVILENSKLPEGVTIAYTSRCKNGVVSEGESGRRCSN
ISIGDEVMFSISVTSKGCPKLGKPEHIKIKPLGFTEEVEIILNFICECECNKDGVKNSPL
CHFGNGTYECGACKCNEGRVGRQCECSSNDVATEDMDRTCRKDNGTDICSNNGDCVCGTC
ECKKRDNPEERYSGQHCECDNFNCDRSGNKLCGGHGHCECRVCVCDPMWTGNACDCSLDN
STCLASNKQICNGRGECECGTCKCTDPKFQGPTCETCPTCPGVCTEHKECVQCRAFGTGE
KKDTCERDCSYFNLIKVKDRDKLPQPNDASYPVMHCKERDANDCWFYYTYAVNNNTEKEV
HVVDMLDCPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKW
DTGENPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences G3NA85
ENSGACP00000002228 69293.ENSGACP00000002228 ENSGACP00000002228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]