SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006502 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006502
Domain Number 1 Region: 94-215
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-27
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 2 Region: 5-109
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-26
Family DBL homology domain (DH-domain) 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006502   Gene: ENSGACG00000004922   Transcript: ENSGACT00000006519
Sequence length 379
Comment pep:known_by_projection group:BROADS1:groupI:696149:703429:1 gene:ENSGACG00000004922 transcript:ENSGACT00000006519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLHSSVGVLRDCMKNKSLVPFFQERQTTLNHSLPLETYLLKPVQRILKYHLLLQELSKH
FDKSDSGYEVIEDAIITMTAVAWYINDMKRKQEHAVRLQEIESLLVNWSGPALRGFGELV
LEGSFRVQRVKKERAFFLFDTMLLIAKKRLDMFVYSTHIFCCNLLLVETLKDSLCFKVSD
QTIPKLQHVVQTKNQEEKRLWVHYLKRLIVENHPASLPQKARQVLGDDFCPSPCFEREDP
KKKKKKSAAPLPRPDDVHSFQRGRRQSGNLPCRRTRRQSAPAKDIEAAFSPQVSKPALKQ
AGSEGEYRKHPIESKPFLLHFASPEKEEDEEELIPLSPPPTLSITEEILEFINRSRAREG
LTAITTHATLSRPTSPPHC
Download sequence
Identical sequences G3NMD9
69293.ENSGACP00000006502 ENSGACP00000006502 ENSGACP00000006502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]