SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011906 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011906
Domain Number 1 Region: 136-383
Classification Level Classification E-value
Superfamily vWA-like 1.78e-82
Family Integrin A (or I) domain 0.00000001
Further Details:      
 
Domain Number 2 Region: 379-468
Classification Level Classification E-value
Superfamily Integrin domains 1.99e-28
Family Integrin domains 0.0000209
Further Details:      
 
Domain Number 3 Region: 635-718
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.67e-22
Family Integrin beta tail domain 0.0000371
Further Details:      
 
Domain Number 4 Region: 28-86
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000136
Family Plexin repeat 0.0002
Further Details:      
 
Domain Number 5 Region: 594-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000156
Family Integrin beta EGF-like domains 0.00081
Further Details:      
 
Domain Number 6 Region: 551-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011906
Domain Number - Region: 514-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011906   Gene: ENSGACG00000008948   Transcript: ENSGACT00000011930
Sequence length 790
Comment pep:known_by_projection group:BROADS1:groupXI:6215349:6223326:1 gene:ENSGACG00000008948 transcript:ENSGACT00000011930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERGITRPRPAPLLELSPPFLISVIIKGSNICTSQGVTTCRQCMAVHPRCAWCSKEEYGKG
GSGASRCDYKENLLKGGCSPAAVEFPSSTLSIDKNAPLSDKASGQADDVTQIKPQKLGIT
LRPGDSQRFTVSVKQAEDYPVDLYYLMDLSFSMKDDLARLRTLGSELADTMGHTTSKLRM
GFGAFVDKTTSPYMYTNPAEALENPCYGIHQKCQAQFGFKHVLSLTEKVARFTEEVEKQQ
VSRNRDAPEGGFDAVMQAVVCKDRIGWRPDASHLLVFTTDAKTHIALDGRIAGIVQPNDG
KCHLDNENVYNKSTVLDYPSLALMTEKMSENNINLIFAVTDYVVPLYKEYSQLIPGTTVG
TLSDDSGNVIKLIVDAYAKIRSKVELELLGVPEELHLSFNATCLNEEVIPGLKSCSGLKI
GDTVSFSVEAQLRVCPKEKRHSFTIKPRGFKDSLEVTVDFACGCDCEADAKADSPLCSNG
NGTYECGVCQCHPGRLGPRCECSVEDYSPSDDANCIPKPGAPICSGRGDCLCGQCSCHGN
EFGQVWGKYCECDDFNCLRFKGALCSDHGKCSCGLCQCDAGWKGENCNCSTVVDTCMSSI
GLLCSGRGSCQCGVCQCTQPGAYGDTCEKCPTCPDACTIKKECVECQHFKRGQYIEDNSC
SIICKNEINLVEELGFHANAVNCSYKDENDCVVHFQYYEDGSGKSILDVVKEPECPQGAD
ILVVLLAVAGAILLLGLIGMLIWKLLVTIHDRREFVKFEEEKAKAKWDTANNPLYKEATS
TFTNVAYRGN
Download sequence
Identical sequences G3P2T3
ENSGACP00000011906 ENSGACP00000011906 69293.ENSGACP00000011906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]