SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012536 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012536
Domain Number 1 Region: 625-1025
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.1e-95
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000504
Further Details:      
 
Domain Number 2 Region: 24-287
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.49e-63
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000281
Further Details:      
 
Domain Number 3 Region: 293-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.79e-60
Family Lipovitellin-phosvitin complex, superhelical domain 0.00000115
Further Details:      
 
Domain Number 4 Region: 1082-1250
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 7.45e-45
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012536   Gene: ENSGACG00000009490   Transcript: ENSGACT00000012560
Sequence length 1271
Comment pep:known_by_projection group:BROADS1:groupVIII:12030003:12039117:-1 gene:ENSGACG00000009490 transcript:ENSGACT00000012560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGLLLFCLVALAASQSVHYEPGLSPKKTYKYKYVGDVNFGLGKPNLAESATRISCNIKI
AGASQQTFILQVSDFAFEDFNGVKGRNRFTAVPKLTERIASQLVKPFMFDYVGGHVSNIR
TSAKTSDTIVNLVRGILGLFHVTVKTTQRIYELEEVSIHGVCPSHYATEVNEETKDMAVI
QVVDISNCREKAAIYKGMATAVLDDVGKQRGESIVSTVRCVYTVKPTADGGLITRAHGHE
QQNFSPFNVKGGNFKMEAVNEMVLLSVNDTVGAVEPGPMESKGNLVFMFTDAEINLPIVM
QNLEDPITKAAELIKHLAEANRYHIDSTTSEDTIKLYQLLRAMPYEGLDILWKQFAGNEE
QRRWFLDMIVEINDARILKFLQARFQARDVTASEAWQTLLLAFNHLQTDANLVEMAKMFL
DMPFCKSDVELWHTVVLSYGSLVYKHCAYATPCPAATVQPLLDMAVESLRIRNHDDMVLA
LKALGNAGHPSSLKTIMRFLPGVAATPVDLPPRVLSAAVQSMRLIAARDPLSVQDITMSL
FLQKNNPTEIRMLAFMILFDTKPSMAVVSIVTVHLQEEKNLHVISFAYSYLKSVSRSSTP
NNHFLSTACNVAVKILGPRYSRLSYHYSKAIHMDWFNDADDFLIGTATEVFMLRSATNIF
PTEILMKGEFYFIGRILQLMELGIRADGLKELFANGIPGFKGDLGFSDFQAVLNVLKNWE
VLPNDKPVLSAYSRASGQEWFFADLKKETIQNIVKFFRQSASKGSFLWAAIENLQKGVSW
HRTKPFLIVEVRYFQATILGLPLEISKYYETINGISVNATASINPPLTERLGQLFTSDIS
LETDGFIGYTKDFWLYYGINTELFQCGSEFKAKTPIAIPWKFSAKINIAKKKFELNFPPC
KKEFNLLSLSSNVYAVSRNIEEPDLDKRTPMIPDSNDEVFQKGPTVETAQTDQILTQGNW
TQKDKMCVESNIYGAGVCVEYDLRREFYHDEYPLYYFLGYTHVAVKVLPAQAINAVDKIH
FEINAGPSSHPASAQELLESLSQILKHGADAVHTGNEVNAGHTRINWTAFYLTQQMGNST
FEAVFNVNAFAVSGAKKPEGYNAVFYYTTEEVKKTQLVVSHVKENSNWKICIDTSVKALV
GAKANIKWGAECQSYEMSITSETAHLPGTLPTIKAKIHWSRMPEKVTQACSRLESYIPGM
ALLLNFYQKQEKNAGQEISASVIASSADSIDVRIQLPEYTIFRQAISFPMPPVIFQEFEH
DNTTMDSFGRA
Download sequence
Identical sequences G3P4L3
69293.ENSGACP00000012536 ENSGACP00000012536 ENSGACP00000012536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]