SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012743 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012743
Domain Number 1 Region: 224-597
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.22e-57
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0096
Further Details:      
 
Domain Number 2 Region: 3-204
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.66e-24
Family Lipovitellin-phosvitin complex, superhelical domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012743   Gene: ENSGACG00000009649   Transcript: ENSGACT00000012767
Sequence length 1648
Comment pep:known_by_projection group:BROADS1:groupXVIII:9356346:9363047:1 gene:ENSGACG00000009649 transcript:ENSGACT00000012767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATVYALGMLSNPSRRMVKDMLAMAQYKQSKPIMYALSNAVRKLYQVEGISPEINDVSDFM
ASLLGGDCAGEKELTFLTLRVIGNMGDAMDAAHADIKNTLVKCMRQPATTLSVQLAAIQA
FRRMSVTEEVRSNLQRVCQYPKGAVQKRLAAYLVLMRNPQDSDIEMVKKLLKQEQNMQMK
SFVTSHVYNIISSTDSETQKLGKKIMDSLQGTDVTTHSDYTTKSRNYKLGLAQENIQAAV
LGNIVFDPSSQLPREVLMETTLKAFGFSIDLWEIGMEGKGFEPTIEALFGKNGFFPDTLA
KTFYWTLDKIPPKMKDELKKWASPLDTEGRKISENLVREVVRNFNKLVKDLQSQETPEAM
AYLKIMGAELGYIKGNDVKFIADNAMITAGENSNVPFCHQVVADLMSRTDNEIFAHYIFM
DNKFLMPTASGLPLTFALSGTFAPGAKGGVRIAPNMKELLFSPSVGVEFVTKMGVHVPEF
VVSGVEMHTNMYHESTLNAKITMEQNQVKLSIPAPQGTTKVLHIRKSNKVLIVGAGQAAA
VANTEGEANCRPLFSGVKYCTKTLHASTGDNTAVPYFPLNGETKFAIDIEPSNDVSEYTA
TIAYKLLSEGKEGQHKVDSLKLALRAEGSQPSEATATMKYNRNRNVFTTQVQVPDFDVEA
GVKIGMTDSSAKGKSITLEITNKNVPQLSLIGRAKLQAMRDGMLQVQLLVPSLKTDAAIT
ATMSKADGLTMEIKSDVKLPETSSIQAVTFNSGEDHAEIQLMSNMNANTKILVPYTEAAQ
AWLRQLVNDVMNQQVVKTDMKLRHVFNKAVEASNIWMDKISADVPYVETLRNRIESAEMP
SMPEKLFMTCNDSTFRYKFNQERFTITVPLPLGGKSSEELRIPPMVKSPLISMPQLGVEF
ASKEIQMPTFTIPSEYDLTLPLMGMVEGSAKVVSNYYNWEATVSAGNNTAESPSYLAKFS
VVADSPIELLSFSTEGATTIKDTAEETIKFTFDGSLNHMLMKTGFNVLETFVVTDNVKST
GRYKIYAIAPVGLETSLTVTTQVTLDSEMLSGDFNTDGRVSVGSMTASTTYLYTFSVEPA
KKEATLESTLRVNSDILNAANIIKASYANEELTIESNTNMNTDPIQHTTKMSLGYKDVKL
TIQSDSVTKADQRIIRSQMEFSATDGQASLRIENQAEDTVNRAYSLFTGSVNPSGLEINA
DSSLSVFSSLASHKATLALNMNGLTTSCTTTAQHSPMTFENVFHGGVDTSGATLSLTTKG
AIKENKAELSVEGKIASTDVYLNSVLEGNLFDVNTRNRVNLRLNEDGLILSNNIVGSLNE
MRTENTNSLSLTIRSFVLRSKTDNFLDKKNSYMHDITVNVEQYTASVNVKNDLKIMDINF
ANDALFKAEPYNIELTGTMMGVFSEEELKHTYEVKFVDMVFSAQCNTNGKLLGAQMTHTT
DMEVAGLTMKFNNVANFNSPALRVDSTVKTVAAPFTLSIDAIFNSNGAVYLYGEQSGELY
SKFLLKAEPLVFTQSFEYRASTTHQLGAGSPIKTNMDNKFNSMLSLQEQSLTMKMVSRVN
EHSFDEEVSAYNNAERMGIEMSGAVSTPLFSAAVNDYALSGFVKYDKNSNSHFVQIPFIE
HLPEVIENIKTTMMRLMDQSIEMLKDIN
Download sequence
Identical sequences G3P570
ENSGACP00000012743 69293.ENSGACP00000012743 ENSGACP00000012743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]