SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013225 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013225
Domain Number 1 Region: 199-335
Classification Level Classification E-value
Superfamily PH domain-like 4.43e-43
Family Third domain of FERM 0.00000068
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-37
Family Second domain of FERM 0.00000169
Further Details:      
 
Domain Number 3 Region: 500-587
Classification Level Classification E-value
Superfamily Moesin tail domain 8.89e-32
Family Moesin tail domain 0.0000201
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-26
Family First domain of FERM 0.0000118
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013225
Domain Number - Region: 470-477
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0785
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013225   Gene: ENSGACG00000010010   Transcript: ENSGACT00000013250
Sequence length 587
Comment pep:known_by_projection group:BROADS1:groupXVIII:9679592:9698566:1 gene:ENSGACG00000010010 transcript:ENSGACT00000013250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKAVNVRVTTVDAELEFAIQPSTTGKQLFDQVVKTVGLREVWYFGLQYMDGKGYYTWLK
LDKKVSSQDVKKENPMQFKFRAKFFPEDVSEELIQDVTQKLFFLQVKEGILSDEVYCPPE
TAVLLASYSVQAKFGDYNKDVHRPGYLVSERLLPQRVQEQHKLSREQWEERIQVWHEEHG
GMLKEDAMMEYLKIAQDLEMYGVNYFDIKNKKGTDLWLGVDALGLNIYEKEDKLTPKIGF
PWSEIRNISFNDKKFIIKPIDKKSPDFVFYAARLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKQQKQLERCACQDPEIRRRFVNRTRLQIHGESNHLVMRLYQFEEKTKK
AEKDLQEQLQRAIMLEAERRKAEEEAARLEAERQAALLAKEELARQAEDQQKSQEQLAAE
LAEHSAKISLLEEAKRRKEEEADSWQLRATEAQNDLIKTKEELHMVMTVPPPPPPPPMFE
AMDDNSDSEETASEENNSYHSAELHSEGFNNHRNEEDRLTEAQKNERVQKQLKALTSELA
HARDESKNTQNDLLHSENVRVGRDKYKTLRQIRQGNTKQRIDEFEAL
Download sequence
Identical sequences G3P6K2
69293.ENSGACP00000013225 ENSGACP00000013225 ENSGACP00000013225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]