SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014548 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014548
Domain Number 1 Region: 303-487,595-811,842-873
Classification Level Classification E-value
Superfamily Ras GEF 9.02e-100
Family Ras GEF 0.00017
Further Details:      
 
Domain Number 2 Region: 59-184
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-34
Family DEP domain 0.000031
Further Details:      
 
Domain Number 3 Region: 178-306
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-25
Family cAMP-binding domain 0.00000325
Further Details:      
 
Domain Number 4 Region: 506-604
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-24
Family Ras-binding domain, RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014548   Gene: ENSGACG00000010990   Transcript: ENSGACT00000014574
Sequence length 874
Comment pep:known_by_projection group:BROADS1:groupXII:13896729:13910983:-1 gene:ENSGACG00000010990 transcript:ENSGACT00000014574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEMHLFRSHNYRVYPDRSSVETPSIRGISWTPLPEALNSKDTMKQFLSDRVVKAARSVHS
VMIDGNPGLIRDRKHHLKTYRQCSSGKELVDWLMKQNECLQSRSQAVGMWQVLVDEGILV
HVKHELNFHDKETQFYRFQDSEFGLNHISNEKDSEEELQESLSLLSQLGPDALLTMILRK
CPSQRSAEDLEVIYEELLHVKAVAHLSTSVRKELAAVLVFESHAKAGAVLFSQGEKGTSW
YIIWKGSVNVITHGKGLVTTLHEGEDFGQLALLNDAPRSATIILREDNCHFLRVDKQDFI
RILKDVEANTVRLEEHGKTVLVLEKRTEWAQQGGAGNSKYTVMSGTPEKILEHLLETIKL
DSNGNDSIDPCVSDFLLTHKVFMSTSQLCAALQHQYPEAELSEGSEQEQASYILTTKQKV
VKLIGQWVALYGLLLKEDPVALDSLERLKKEVAGDFRLFSILKEQFRERRRTKLLFYRSE
NGYQTLSRNQPFDWFSNCEEPVGRLQPIRAKDKVLYEIYRPDNKPLTLMLPVNTSVKDVM
SAIVKPGGDHILVKMNSMGERAQLKMDANAVYTALGLNERLFICTSSQAEKLMPLKEQQG
PERGTTDLLEQMGSKDIANELTNYDWELFTAMHEVELVYYIFGLHKFPGAITANLERFVR
RFNEVQYWVVTELCICEDLVKRAILLKKFIKIAAVLKEQKNLNSFFAVMFGLSNSAVHRL
YKTWERIPSKIKRIYCAYERLMDPSRNHRAYRLAVAKLSPPYIPFMPLLLKDMTFINDGN
PNYVDKLVNFEKVRMIAKTVKIVRGCRSQPYVPSSPQRGLADRMFLEGPSTRISTYSELA
FPLRSPSSIRHYIQNLKVIDNQRKLTQLSRTIEC
Download sequence
Identical sequences G3PAC4
ENSGACP00000014548 69293.ENSGACP00000014548 ENSGACP00000014548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]