SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014913 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014913
Domain Number 1 Region: 26-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-90
Family Calponin-homology domain, CH-domain 0.000000946
Further Details:      
 
Domain Number 2 Region: 280-401
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-35
Family Spectrin repeat 0.0000654
Further Details:      
 
Domain Number 3 Region: 1630-1785
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-30
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 995-1151
Classification Level Classification E-value
Superfamily Spectrin repeat 1e-29
Family Spectrin repeat 0.0000247
Further Details:      
 
Domain Number 5 Region: 577-717
Classification Level Classification E-value
Superfamily Spectrin repeat 2.96e-29
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 6 Region: 1524-1680
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 7 Region: 1843-1997
Classification Level Classification E-value
Superfamily Spectrin repeat 5.57e-27
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 802-936
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 9 Region: 1208-1361
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-26
Family Spectrin repeat 0.00067
Further Details:      
 
Domain Number 10 Region: 679-795
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-24
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 11 Region: 410-510
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-23
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 1369-1467
Classification Level Classification E-value
Superfamily Spectrin repeat 4.46e-17
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 13 Region: 481-581
Classification Level Classification E-value
Superfamily Spectrin repeat 6.71e-16
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 14 Region: 2002-2063
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000489
Family Spectrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014913   Gene: ENSGACG00000011225   Transcript: ENSGACT00000014941
Sequence length 2137
Comment pep:known_by_projection group:BROADS1:groupVI:14483985:14514715:1 gene:ENSGACG00000011225 transcript:ENSGACT00000014941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSHATSPIGGPGPGFSGQAAFNYNQLEGRFKQLQDEREAVQKKTFTKWVNSHLSRVSCRI
TDLYMDLRDGRMLIKLLEVLSGEKLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGS
HDIVDGNHRLVLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNI
HNFSTSWRDGMAFNAIIHKHRPDLIDFDKLKKSNAHHNLQNAFNLAEQHLGLTKLLDAED
ISVDHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLL
EWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRA
NNQKVYTPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRE
TWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVSVAKEMESENYHD
IKRITARKDNVIRLWEYLLELLKARRQRLELTLGLQRVFQEMLYIMDWMDEMKMMLLSQD
YGKHLLGVEDLLQKHALVEADISIQADRVRNVNRNAQKFADDMDGYKPCDPQIIRDRVAH
MDFCYQELSQLAAERRGRLEESRRLWKFFWEMAEEEGWIREKEQILSSEDYGKDLTGALR
LLSQHKAFEDEMSGRAAHLQQTIKQGEELVANNHFGADKIKERILDIQEQWAALERLSAV
RKARLQEACNQHQFQADADDIDTWMLDVLRIVSSVDVGHDEFSTQALVKKHKDVAEEIGS
YRPVIEALHEQSGTLPPEKAKSEEVQSRLAGIEERYKEVVELTRLRKQALQDALALYKML
SEASACEVWIDEKEQWLNSMDIPEKLEDLEVVQHRFESLEPEMNNQASRVAVVNQVARQL
IHCGHPSEKEIKTQQDKLNTRWSQFRDLVDQKKDGLSSALGVQNYHLECNETKSWIKEKT
KVIESTQELGNDLAGVMALQRKLTGMERDLAAIEDKLGDLGKEADRLASEHPDQSEAIRG
RLAGITAVWDEMKDTMKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLA
EAEKLLAQHENIKNEIRNYEEDYQKMRDMGETVTQGQTDAQYMFLRQRLQALDTGWNELH
KMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEAAEAAIKKQEDFM
TTMDANEEKIGGVVDTGRRLVTDGNINAERAQEMVDSIDQRHKKNRAAASDLLTRLKDNR
DLQRFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIDK
DGQALMAEKPETEAMVKEKLSSLKTMWQELESTTQAKAKCLFDANKAELFTQSCADLDKW
LAGLDGQLQSDDYGKDLTSVNILLKKQQILESQVEVRQKEVGELQGQSQALSQEGKGSDE
VDGQRISVEQKFQSLQDPLKKRRDNLMASREIHQFNRDVEDEILWVEERMPLATSTDHGN
NLQTVQLAIKKNQTLQKEIQGHQPRYDDIFQRSQHVLRENGPTAELIRQRLAELQSLWEQ
IRKETEKRHTRLSEAHEAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQI
LEQAVEDYADTVHQLSSTSRGLVAAEHPDSERIGMRQSQVDKLYAGLKDLSEERRGKLDE
RLRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVD
TVNQQADELINTGHGDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKE
ILHRILDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAVRLQSAYAG
DKADDIQKREGEVLEAWKNLLEAAEGRRVKLVETGDKFRFFSMVRDLMLWMEDVIRLIEA
QEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKALLARKHYASEEIKEKLLQLT
DKRKDMIDKWEDRWEWLRLVLEVHQFSRDAGVAEAWLLGQDPYLFSREMGQSVDEVEKLI
KRHEAFEKSAATWEERFSALERLTTMELLEVRRMQEEEEKRRQPPPTEAQPGDAAAQHRS
AEGELVSQNGLPSDQESTRVSYRSPAYQQYSSILQNR
Download sequence
Identical sequences G3PBD9
ENSGACP00000014913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]