SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015412 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015412
Domain Number 1 Region: 29-156
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-37
Family Pleckstrin-homology domain (PH domain) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015412   Gene: ENSGACG00000011651   Transcript: ENSGACT00000015442
Sequence length 1159
Comment pep:known_by_projection group:BROADS1:groupXVII:13104798:13130544:1 gene:ENSGACG00000011651 transcript:ENSGACT00000015442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGKVNNPSERITHSKSANMVSDLSTETQPYTRTSRTPRTAATFGKRSNSMRRNPKAEVT
KHGWLHKQASSGVKQWNKRWFVLTDRCLFYYKDEKEDTVLGSLPLLSFQIKGVEPSDNIT
RKFAFKAQHAGTRTYYFSADSHEEQKEWIKAMNEAAEVNIQQTQRMNTIEDPNHTMATKA
TNQQTQQPPHTQRHCDTDIENTPHPKINVLNSPETPTPSTPCSKQAGKNTDGRKGEGEVE
GEGPVPDNASHPSHHPNGWGSHSQHCAPQGHPGGGVSPSYDPTEQQDNVVLRRGFVPRTA
PERVAQRKTSMVQLQQWVNHRRTMASQEDIHSLSSYYPVNHGVLDDYFGYPGGPPYMEEY
PLYPPGMRPDSICSVSALGGYNRRWTFEEKRHSLRDRSQLYGSTMPRDQWAPTYCGGMET
SMRRLSIQPRSRSVPRSPSLSSGGPYSPVPHNFASPARSTSGCFNRFPGRMREDVIYADP
SVYSLRRSLSPPKYDCPGYRRSLSQGLYNYNYPVTPSIRNKMTQEDILDLQLQRNLDYLD
QQSLGDLVSLTVTFNLPQKTKNPRQCSLSQVPPFYEVFSRELHPTLKLNEIETSKLLSRL
CEQNGIWKEHEAVVHRLRMEKDSLEEALVITHQELELFHTQPLALDKLRLKKDTLQNQLV
NIRGQLSQASSALTTSRMEFEALEDEANAIHGDLWEQLNAGGQSELVHRHIQKEFWRVQD
VLEGLHKNNSSRGTDTAKHKGITGRTVASGASGSFSPLSSVSFTSPLSPFSPVPGSQSPP
PNSWARSQEESVPPRPPLPKSYHPLEPSLTFPPSIPPLPFDSTAWLRSLGIDDGYLDGED
SQNRKVFGCFCFHPPLASPSPNYKMQSGFAEQNISDVQDQSQDRQSTMNKVGIVPPRTKS
PTDKSHSSSTGDTVHNGRCTNGILRFSTQERPKSAVFPAELKSKMSVEEQNERIRRHQSS
SVRDKRRSLNLSGGQSPANYKVIRRRLTAHEIDINDLEAAVRGQGQESPREEIARLRRLR
IEPEAHNLGSSKELVTSNKVVIPERYMDVEEYAPLSPEEQKEKQKKLVRIKTLIAKSNLQ
NMVPLLDGPGGAGAPVNSQQQMQEQEKRMEISCALAAEASRRSRLFSAQCAPSPPSSPSS
PDPPPSSADFPNSAHVLKS
Download sequence
Identical sequences G3PCT8
ENSGACP00000015412 ENSGACP00000015412 69293.ENSGACP00000015412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]