SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017151 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017151
Domain Number 1 Region: 481-559
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.95e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0000128
Further Details:      
 
Domain Number 2 Region: 278-317
Classification Level Classification E-value
Superfamily WW domain 0.00000128
Family WW domain 0.005
Further Details:      
 
Domain Number 3 Region: 595-664
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000281
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017151   Gene: ENSGACG00000012975   Transcript: ENSGACT00000017185
Sequence length 751
Comment pep:known_by_projection group:BROADS1:groupXIII:15442577:15448352:-1 gene:ENSGACG00000012975 transcript:ENSGACT00000017185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVDDVLPPLPLEPPVDFGRDEGIAPPPPPLQTSSDAEVMDVSSGGDGYTYTPGDGEAHP
QQPSITFHSDLSDEANPIPPCPRTARHAPQLAGFLPDLKLLRDVKIRVSFTDSSNSKDRK
VLYTGEGQEGGSGDGLESVNGELHDSASELEAPEGNDIAGRRAEEAEVDLENKVEFAVLD
ELDDLYDNFLDNDDAELGGFKSEVIVQQEQADEEAVAFSYEEEFDNDVDALLEEGMPVPK
KMRPSEDKYGGDSDHPSDGEEGGVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGIP
VYLHRETRVVTWSRPYFLGTGSIRKHDPPTSSIPCLHYRKMKDNEERELNGEVTAMSEEV
PNAAETPVKPSYEANGDELADKSDATDAHLCEIAHGALGQVKAKVEVCKDESIELEEFRL
YLEKCFDFEQVTVKKFRTWAERRQFNRDMKRKQAESERPILPANQKLITLSVQDAPTKKE
FVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVIIDGVTYGTGTASSKK
LAKNKAARATLEILIPDFVKQTSEEKPVEGDELEYFNHINIEDSRVYELTNKAGLLSPYQ
ILHECLKRNHGMGDTSIKFEVIPGKNQKSEYVMTCGKHTVRGWCKNKRVGKQLASQKILQ
MLHPHVKNWGSLLRMYGRDSNKMVKKESSDKSVIELQQYAKKNKPNLHILNKLQEEMRKL
AKQREETRKKPKMTIMESAQPGSEPLCTVDV
Download sequence
Identical sequences G3PHS5
ENSGACP00000017151 ENSGACP00000017151 69293.ENSGACP00000017151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]