SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018586 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018586
Domain Number 1 Region: 68-171
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-16
Family Second domain of FERM 0.0000174
Further Details:      
 
Domain Number 2 Region: 391-461
Classification Level Classification E-value
Superfamily Moesin tail domain 0.00000000000196
Family Moesin tail domain 0.0049
Further Details:      
 
Domain Number 3 Region: 172-245
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000274
Family Third domain of FERM 0.0000872
Further Details:      
 
Domain Number 4 Region: 2-64
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000184
Family First domain of FERM 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018586   Gene: ENSGACG00000014073   Transcript: ENSGACT00000018622
Sequence length 477
Comment pep:known_by_projection group:BROADS1:groupXIII:18076604:18087798:-1 gene:ENSGACG00000014073 transcript:ENSGACT00000018622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVKWKGKDLFDLSVPDSGEETWFFGLRYDIKDTAWLKMEQKVLDQEVPKEEPITLHLLAK
FYPESAEEELVQDITKHLFFLQVKKKILEEDIHCPPEASVLLASSAVHAKKTYYKNFAPA
LLRRGFISRQQLQNRQVTNLYQMAEMWEERITGVLHRGRTRDEAEMEYLKNNFSIRNHGG
TDLLLGGDLGLHIYELDNRLTPKCSFPTEIRNVSYSDKEFTIKPVDKKTNTFEFNSSRLR
VSKLVSSAETDWLVSRREGGCVRKHAADLLAEKAQMAEEEARLLALKAGEAEAETQRVKV
TAIRGREERRLLEQKMLEAEMLALKTAEESERRHPRRERKKAFLQQPRSSETQAVHLRCS
SSNPPPHHLPSKAPAPQCDSMPPDLSFSRENLSFDFKDSDMKRLSVEIEKEKVEYMEKSK
QLSELKTEIESLETKERETPLDVIHSQHSEQGTSKHGNFKKTVLRHRRSNIYFGSQL
Download sequence
Identical sequences G3PLV5
69293.ENSGACP00000018586 ENSGACP00000018586 ENSGACP00000018586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]