SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018905 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018905
Domain Number 1 Region: 2712-3000
Classification Level Classification E-value
Superfamily BEACH domain 3.27e-124
Family BEACH domain 0.0000000185
Further Details:      
 
Domain Number 2 Region: 3068-3268,3421-3469
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.7e-32
Family WD40-repeat 0.002
Further Details:      
 
Domain Number 3 Region: 2558-2680
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-22
Family PreBEACH PH-like domain 0.016
Further Details:      
 
Domain Number 4 Region: 3477-3546
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.25e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Domain Number 5 Region: 475-514,586-664,869-933
Classification Level Classification E-value
Superfamily ARM repeat 0.000000669
Family HspBP1 domain 0.076
Further Details:      
 
Domain Number 6 Region: 1431-1482,1534-1602,1634-1722
Classification Level Classification E-value
Superfamily ARM repeat 0.0000046
Family HspBP1 domain 0.049
Further Details:      
 
Domain Number 7 Region: 1116-1253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000461
Family Laminin G-like module 0.07
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018905
Domain Number - Region: 119-421
Classification Level Classification E-value
Superfamily ARM repeat 0.00273
Family MIF4G domain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018905   Gene: ENSGACG00000014318   Transcript: ENSGACT00000018943
Sequence length 3553
Comment pep:known_by_projection group:BROADS1:groupXIII:18804155:18849317:1 gene:ENSGACG00000014318 transcript:ENSGACT00000018943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFSELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPTTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEVNQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHMAEAPGHTQQELPLA
DRRVLLQKVFVQILVKLCTFVSPAEELAQKDDLQLLFSAITSWCPPHNLPWRRSAGEVLT
TISRHGLSVNVVKYIHEKECLGTCVQNMQQSDDLSPLEIVEMFVGLSCFLKDSSGVSQTL
LDDFRMCQGYAFLCDLMLRLEQAKEDESKDALKDLVNLVTCLTTYGVTELKPAGLTTGAP
FLLPGFVLPQPSGKGHTVRNIQAFSVLENAFLRAKTSRLASMLLDAIGNIYSAEPANYFI
LESQHTLSQFAERVAKLPDSQAKYFELLEFVVFSLNYVPCKELFSVSVLLKSSTSHACGI
TAVRTLLKLSRHDAVFSDVLREVGLLEVLVNLLHKYAALLKDPATQQPHSNEHADCKNNT
VAEEQKQLAWLVMETLTVLLQGSNTTNTNAALFREFGGARCVHNIVKYRQCREHALLIIQ
QLVLSPSGDDDMGTLLGLMHSAPPSELQLKTDILRALLAVLRESHRTRTVFRKVGGFVYL
TSLLVAMERSLCQPPRHGWERVNQNQVFELLHTVICTLTAAMRYEPANSHFFRTEIQYEK
LADAVRLLGCFSDTKKLGPTSVFPSNAQPFQRLLEDEAVPGGCVGDSVCPTLKHCSKLFI
YLYKMATDSFDRPCSRAEQVPPCLTHETSLPSPWGTPALARKRQGYYGTSGPPAPVKALT
DLKLHLANASHPASSSSSSDTVVIHPGAVLAILDLLPSVCSDSQPEHALDLQLAVANILQ
LLVNSERNQQVLCEACLHQRLLQRCSQALGDEDHPLHPPLQRMFERLASQAVQPMALSRE
FLRLGNPLNCGAWDKKLLKQYRVHKPSSLSYDGEMRNSMTMSMEGFGPDSVFATPAEDNG
QYRISRSLVRSAEGSTVPLTRVKCLVSMTTPHDIRLHGSAVTPSFVEFDTSLEGFGCLFL
PSLAPHNGPTNNTNASGVSDGAVLSGIGTGRERLFPPPSGLSYSTWFCVERFSAAPQAHP
VRLLTVVRRATSSEQHYVCLAVVLSAKDRSLTVSTKEELLQSHSDDSREDSFFYEILPCC
ARFRCGELIAEGQWQHLVLVMSKGMLKNSMATLYLDGQLVNTVKLHYVHSAPGGSGSTNP
PVLSTVYGYVGTPPAQRQLSSLVWRLGPSHFLEEVLPAASVAAVFELGPIYVGSFQAVYL
PCKDSKAEGAPASLVALVPEEKVSFSLYALSVSTLTVAKIRKVYNKLDSKAIAKQLTVSS
HENATPVKLIHNAAGHLNGPARTIGAAVIGYLGVRVFVAKPVATNLQYVGGAAAILGLVA
MASDVEGLYAAVKALVCVVKSNPLASKEMERIRGYQLLAMLLKKKRSLLNSHILHLTFSL
VGTVDSGHETSIIPNSTAFQDLLCDFEVWLHAPYELHLSLFEHFIELLTESRNSEAAKNA
KLLREFQLIPRLLLTLRDTSLSQPTVAAISNVLSLLLQGFPNPHDLLRFGQFISSTLPTF
AVCEKFVVMEISNEEKIDGGNDDDFGGLLSASLILLRNRLLDNLLRLLFTTKEKCTVNAQ
ACEELVRTLGFDWLLMFMEEHLHSTTVTAALWILVVLLSNQAILNRFKEGLCGGGWLDHT
DSVLTNKIGTVLGFNVGRSAGGRSTLREINREACHFPGLPVLQTLLPKHTNVPELYFLLM
ALFLQQPVTELPDSLQVHVSMPPVCLSPQFDLDSIWTFIFGIPASSGAVVGSIHNVYTEA
AFLLLAMLRSMLNLPWQSEEEGSWLREYPVTLMQFFRYLYHNVPDLAPMWHSAEFLCALA
ATVFPFNIRPYSEMVTDLDDEAGSPTEEFKAFAGDSGMNRSQSEYCNVGSKTSLTNHPAK
KYVFDFMRVLIMDNLCMTPASKQTPIVDLLLEQASPERSTRTQQKEFQSNILDGVMEHLL
AADVLLGEDASLPLSSGGSYQILVNNVFYFSQRVVDKLWQGMFNKDSKLVVDFIVQLIGQ
SKRRSQGLSLDAIYHCLNRTVLYQLCRPHKTVAQQVALLDALRVLTVNRNLVLGPGNHDQ
DFVACLAHSFICLHSGSSVEGFGLEAEARMTTWHVMMPTENEADAAHSHDVSEGRQLLLK
AVNRVWTELMHSKRQMLEDIFKVSLPCNDRGHVDIATARPALEEPALKSWQNHLVHEKKC
ISRGEAAAAPATQSKLSRVSSGFGLSKLTGVRRNKRENSLNKNNLSAQETFQWMFTHIAV
VRDLVAMQYKEYQERQQNTLKYVTEDWASIEYELLRERGLWGPPIGSHLDKFVLEMTEGP
CRMRKKMVRNDMFYIHYPYIPEMEPNTNSAQVSPAFNPEVTEETILKQKPLRYRRAISYD
SKEYFVRLLSGNPGMYQHSVEHSTEGETTRHEPEHGEDTIARVKGLVKAPLKRSRSTADG
ADEDSQEQLQEQLLESGGPEEEQRTDNTSLLRLLEEGEKIQHMYRCARVQGLDTSEGLLL
FGKEHFYVIDGYTMTVSREIRDIDTLPPNLHEAIIPRGARQGQSQLKRTCSIFAYEDIKE
VHKRRYLLQPMAVEVFSADGRNYLLAFQKGVRNKVYQRFLAVVPSLADSSESVSGQRPNT
SVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADF
DSEELDLNNPKTFRNLAKPMGAQTDDRLTQYKKRYKDWEDPTGETPAYHYGTHYSSAMIV
ASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWLSASKHNMADVKELIPEFFYLPEF
LLNANNFDLGAKQNGTKLGDCILPPWAKGDPREFIRVHRDALECDYVSAHLHEWIDLIFG
YKQQGPPAVESVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPK
RVRGKANGDVASVPPSSNGDKIFFHHLDNLRPSLAPVKELKEPVGQIMCTDKGILAVELN
KVLVPPTWSKTFAWGYADLSCRLANYESEKALVVYECLSEWGQILCAICPNLKLVITGGT
STAICVWETGTSKERAKALTLKQALLGHTDAVTCLTASSAYHIVVSGSRDRTCIIWDLNK
LSFVTQLRGHRAPVSALCINELTGDIVSCAGTYIHVWSINGSPIASANTFTGRSQQILCC
CVSEMNEWDTQNVIVTGHSDGVVRFWRMEFLQVPETPAPEPAEPDVPDCCGEEKIEGAEN
HNGEDDSSESDADDPGPVQEPKAPRNPSTGGGSQPGSAVHRARGPSARPGASWSMDSGSD
SSHRWSDTLSIDEKDGFVFVNYSEGQTKGHPGCVAQPPSVDARTYNQLRAGYRWERQLVF
RSKLTMHTAFDRKDNAQPAEITSLAISKDHSKILVGDGRGRVFSWSVSDQPGRSAADHWV
KDEVVDSCSGCAVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRVCQNCHYN
LQHERSAEDGSRN
Download sequence
Identical sequences G3PMS2
ENSGACP00000018905 ENSGACP00000018905 69293.ENSGACP00000018905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]