SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019914 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019914
Domain Number 1 Region: 160-254
Classification Level Classification E-value
Superfamily TAFH domain-like 1.83e-34
Family TAFH domain-like 0.00000625
Further Details:      
 
Domain Number 2 Region: 429-477
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000578
Family TBP-associated factors, TAFs 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019914   Gene: ENSGACG00000015092   Transcript: ENSGACT00000019952
Sequence length 641
Comment pep:known_by_projection scaffold:BROADS1:scaffold_68:369249:375714:-1 gene:ENSGACG00000015092 transcript:ENSGACT00000019952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAIAPQVLAPRLTQPQQATPNIQNIQLPPGMVLVRSESGQLLVIHQQTLAQMQAQSQSQS
AMTPRAAAPTSTPPVQIASLQAPGASPLARPVAPTAIIKQGSAVQATVTPTTTLQRPPIL
QLMCLNRVHTQPEPLGTPTPVQAGPAATQRATGTPVTPTAVTAETLENVKKCRNFLSTLI
KLASSGKQSSETIANVKELVKNLLEAKIEPEDFTSRLYRELNSSPQPYLVPFLKRSLPAL
RQMTPDSESFIQQSLLPQPAAATSTALTAVVLRPPVSTASSSPAATKTTVISLTQTPPSK
PALQHGTLVRPQVALAQSPMGTLRGQPHSRIVVSHPQVVKQQPTVTHPAMKQTLAQGAKG
LQVVSQASLIAAQRNKLKEAGGGTFRDDDDINDVASMAGVNLSEESDRILATNSELVGAV
TRSCKDEAFLSTALLARRALEIGRKFGVSELGPDAANFIAHATQQRLRHLLERVSLVAQH
RNGTFKEDERCEQASDVRTQLRFFEQLDKAAKVRILAQRHNVLLISRQSRSRQEDPEQLR
LKQKAKEMQQQELAQIRQREANLTALAAIGPRKKRKMDSPVRGASAEGSGPGPCQPGGSG
GSGSRQFTRQRITRVNLRDLLFCLENERGTSRSHLLYRGFL
Download sequence
Identical sequences G3PQM9
ENSGACP00000019914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]