SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020023 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020023
Domain Number 1 Region: 125-369
Classification Level Classification E-value
Superfamily vWA-like 2.22e-81
Family Integrin A (or I) domain 0.0000000797
Further Details:      
 
Domain Number 2 Region: 368-453
Classification Level Classification E-value
Superfamily Integrin domains 1.62e-22
Family Integrin domains 0.0003
Further Details:      
 
Domain Number 3 Region: 19-76
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000251
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 619-700
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000248
Family Integrin beta tail domain 0.0018
Further Details:      
 
Domain Number 5 Region: 535-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number 6 Region: 578-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family Integrin beta EGF-like domains 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020023
Domain Number - Region: 79-141
Classification Level Classification E-value
Superfamily Integrin domains 0.00994
Family Integrin domains 0.0021
Further Details:      
 
Domain Number - Region: 501-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Integrin beta EGF-like domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020023   Gene: ENSGACG00000015179   Transcript: ENSGACT00000020061
Sequence length 782
Comment pep:known_by_projection group:BROADS1:groupII:6309463:6318567:1 gene:ENSGACG00000015179 transcript:ENSGACT00000020061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLLLSLILRHWIGSVEGSCPAGSAVTCDDCLQLNSHCAWCTQENFTDWFSVGDRCDTP
DILLEKGCARDQLEFPVSKSHILQDRPLGKKTGSVNSTQISPQKMALQLRPGSQLTFQVK
IQHTEDYPVDIYYLMDLSASMIDDLAMIKDLGSSLSKEMAKLTSKFRMGFGSFVEKPVLP
FIKITEEELANPCSGVASTCLPTFGYKHVLSLTSNTDKFNEIIAKQRVSANIDLPECGFD
AIMQAAVCGDKIGWRKDSMRLLVFVSDADSHFGMDSKMAGIVIPNDGQCHLDSNNEYSMS
TVQEYPTLGQLVDKVVENNILLIFAVTKDQTRNYKNYANIIPGATVGVLAADSRNILELI
VAAYKELRSEIELEVLGDTEGLQMSFTAICPNGAVLPDQKRCSNIKTGETVVFNVSVELP
GCVSEPLHFSLKPVGLRDSLEVELSSLCSCDCPPRPPGANGSRCAEGQGAFQCGVCVCRP
GFLGAECECNEESALSSNCVANNETETCSGQGDCFCGQCACHPSSFGRVYGPHCECDDYS
CVRFRGELCGGHGVCDCGECHCTRGWTGEYCNCSSGAEACASEDGALCSGRGRCECGRCV
CSVPGASGDRCEKCPTCGDSCSAARTCVECHLQDEDDVELCDQKCSVPNISVNATADHDK
SPSMQCTLMMENECWISFNVVEGETGTTAYDLQMLGCPEPPNIPMIILGVSLSIVSIGVI
LLAVWKMLVSVHDRKEVAKFEAERSKAKWQTGTNPLFKSSTSTFKNVTYKSRERERIITQ
DN
Download sequence
Identical sequences G3PQY8
ENSGACP00000020023 69293.ENSGACP00000020023 ENSGACP00000020023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]