SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022489 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022489
Domain Number 1 Region: 62-344
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.18e-55
Family Asparaginyl hydroxylase-like 0.068
Further Details:      
 
Domain Number 2 Region: 890-1119
Classification Level Classification E-value
Superfamily RNI-like 3.14e-29
Family 28-residue LRR 0.049
Further Details:      
 
Domain Number 3 Region: 614-688
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000201
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022489   Gene: ENSGACG00000017026   Transcript: ENSGACT00000022531
Sequence length 1145
Comment pep:known_by_projection group:BROADS1:groupXIV:6641855:6658864:1 gene:ENSGACG00000017026 transcript:ENSGACT00000022531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLARLRYSFRQRSICRRLYDENEDLSDVEEITNIRGFSVEEKLVSDSYSATFVHFMEGK
DFSYEYVQRDALRTPLIFKEKEGLGLRMPDPEFTVSEIKGLVGSRRSVDVMDVSTQKGSE
MSMSQFARYYETPEEERDKLFNVISLEFSHTKLESLIKRPTVVDQVDWVDNMWPPDLKQS
QTEATNVISDMKYPKVQRYCLMSVKGCYTDFHIDFGGTSVWYHVFKGQKVFWLVPPTPHN
LALYEDWVLSGKQSDLFLGDRADGCQRVGLEQGYTFFIPSGWIHAVYTPVDTLVFGGNIL
HSFNIPMQLTIHEIENRTKVHSKFRFPFYFEICWYVLERYLHCLTKRSYFSQELHKEPVL
TDYETKGNTQSPSSDTRSRDTNEDSCDTRVREGQGDKPEKAAQEGPCCPDSQRSQHLKAV
LSVHSEDSCNPGSAPLESPQTPSDSSGSEATNKWMHLTEFELSGLRKLVEKLELLPENKK
CVPEGIENPQALLENMKVVLKEHADDDPKLAITGVPVVYWSTQMKIHLSRICFFSKPRPP
NRPKPKMAASPASAVKLSAGRGTSGARRRRTRCRKCEACLRTECGECHFCKDMKKFGGPG
RMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEDEEEKFNLMLMECSICNEIVHPNCL
KVKDSNGVVNDELPNCWECPKCNHAGKTGKVSIRVDLNLLASKQKRGPGFKYASNLPGSL
LKEPRLNRDSKEDPDPPLLATATVNALTAASAVKRKAEREEIPKAREEEPAKKRPPLLSL
DAVLRPRPEENPLRKKRKLFDTHDEPVMVKKKKNNNIVTKLQFIKKLLKPDDPLTLKLLR
QIKTENDQGDEEDDLEDHKEDGFPLGRVYLKDAMRREMWMTVFGHLAHRDLCVCMRVCRT
WNRWCCDKRLWKRVNLNRCKSITPLMLSGIIRRQPVALDLSWTNISKKQLGWLVNRLPGL
RVLLLSGCSWVAVSALCTSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQLDNRSK
LRNVEELRLAGLDITDTSLRLIIRYMPSLSKLDLSYCNHVTDQSVNVLTAAGTTTRDSLT
DINLSVCNRVTDQSLTYFKRCGSVCHIDLRYCKQVSKEGCDRFIAEMSVSVQFELIEEKL
LQKIS
Download sequence
Identical sequences G3PY00
ENSGACP00000022489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]