SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023402 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023402
Domain Number 1 Region: 437-839
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.25e-134
Family Ankyrin repeat 0.0000000000155
Further Details:      
 
Domain Number 2 Region: 203-449
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.41e-68
Family Ankyrin repeat 0.00000436
Further Details:      
 
Domain Number 3 Region: 47-279
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.31e-55
Family Ankyrin repeat 0.0000294
Further Details:      
 
Domain Number 4 Region: 1455-1538
Classification Level Classification E-value
Superfamily DEATH domain 1.14e-21
Family DEATH domain, DD 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023402   Gene: ENSGACG00000017699   Transcript: ENSGACT00000023448
Sequence length 1748
Comment pep:known_by_projection group:BROADS1:groupXIV:8996130:9029956:1 gene:ENSGACG00000017699 transcript:ENSGACT00000023448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSQTFTRCRKLKKVEARRERNTSMDSNRIHLQYMNSSSLQADASTSFLRAARSGNLDKAH
DHLKNGISINIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAG
QEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLA
VALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKVDWFT
PLHIAAHYENMSVAQLLLNRGSQCKLHPQNGITPIHIASRRGNVMMVRLLLDRGAQIDAV
TKDELTPLHCAARNGHARIIEILLEHGAPIQAKTKNGLSPIHMSAQGDHMDCVRQLLQYN
AEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMD
LLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLIQRGASPNASNVKVETPLHMASRAG
HCEVAQFLLQNTAQADARAKDDQTPLHCAARMGHKELVKMLLEHKASPDSATTAGHTPLH
ISAREGHIHTIRILLDAGAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKN
GLTPLHVAVHHNNLDVVRLLVSKGGSAHSTARNGYTSLHIAAKQNQIEVASCLLQNGATP
NVESLQGITPLHLASQEGRPDMVALLISKQANVNLGNKSGLTSLHLVAQEGHVGIADTLV
KQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRMGYTPLHQAAQQGHTD
IVTMLLKHGAHPNEITSNGTSPLGIAKRLGYISVIDVLKLVTEESVSAITTEKHRMSFPE
TVDEILDVSEDEVCRPCSVLRGDELLGMDGARYLKLDDFKDQDDDFLSPKKSLRDFEGGL
GTTPYSPAIPRIPCVSPETVLLDQHTPVPLPKEYDDDSLIPSSPATETSDNVSPVASPIH
TGFLVSFMVDARGGSMRGSRHHGLRVIIPPRTCTAPTRITCRLVKPQKLTTPPPLVEGEG
LASRIISLGPSSMQFLGPVIVEIPHFASLGRGDRELVVLRSENGAVWKEHRNRYGDEVLE
TILNGMDEDLESHDELEKKRIRRIISTDFPLYFAVVSRIQQESELIGPEGGRLTSQLVPR
VEAIFPETAVTKRVRLGLQAQPIPDEMLTRHLGNQATFSPVVTIEPRRRKFHRPIGLRIP
LPPSWRESPRDAGEGDTTSLRLLCSVIGGTAPAQWEDITGTTKLMYAHSCANFTTNVSAR
FWLADCPRTAEAVTFANLLYRELMAVPYMAKFVIFAKMNEAREGRLRCYCMTDDKMDKTL
ELHENFSEVARSRDIELMEGMPLHLECSGNLVPIRKATQQPRSFSFQAFRDNRLPVSVKV
RDSNKEAAGFLSFLRKCTKYEETQHVLCNLNITMPPCVKVAGSEERRRTLTPLALRERYS
ALNEPGVATVNAMQRTELKINIISEQLGLSWAELARELQFGVDDINRIRVENPNSLLEQS
SALLNLWASREGKRAKMESLYAALKNIDRADIVTSLEGQVPQAAPGFLEEGACRLGDRDS
TLLSPSVLNGYGLVQEELLSPASMQYSLPSPLGSEPYWQEVSSLECAPIATTEEDTLMEM
SEVQVWPAGVSPSLVTVEDYSLEGSSRADDSEGATLSLPCSWGRPSSGASGPQEPATALA
EWDRVRASGAVPKVNLNGQLGGQRLEGRRGEVIALGLGSVEGISVVAGQQVYAQRYEMSG
VSRALEHN
Download sequence
Identical sequences G3Q0K7
69293.ENSGACP00000023402 ENSGACP00000023402 ENSGACP00000023402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]