SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024850 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024850
Domain Number 1 Region: 3-302
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.74e-85
Family G proteins 0.000000000237
Further Details:      
 
Domain Number 2 Region: 519-625
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-24
Family Pleckstrin-homology domain (PH domain) 0.00000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024850   Gene: ENSGACG00000018797   Transcript: ENSGACT00000024899
Sequence length 866
Comment pep:known_by_projection group:BROADS1:groupIX:14529429:14542505:-1 gene:ENSGACG00000018797 transcript:ENSGACT00000024899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRGMEDLIPLINKLQDAFSTIGQTCNLDLPQIAVVGGQSAGKSSVLENFVVRDFLPRG
SGIVTRRPLILQLVNSKVEYAEFLHCKGRKFVDFDEVRLEIEAETDRITGSNKGISSIPI
NLRVYSPNVLNLTLIDLPGMTKVAVGDQPVDIEHQIREMLMQFITKESCLILAVTPANTD
LANSDALKISKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQK
DIDGKKDIRAALAAERKFFLSHPGYRHIAERMGTPHLQKTLNQQLTNHIRDTLPGLRSKL
QSQVLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKCIEGSGDQVDTSNLSGGA
KINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQIIKL
KDPCLKCVDLVVTELVTLIRKCTEKGRQLGSYPRLREETERIVTTYVRERDSKTVSQVLL
LIDIELSYINTNHEDFIGFANAQQRTAANATKKRVMPNQVIRRGWLTINISIMKGGSKDY
WFVLTAESLSWYKDEEEKEKKYMLPLDNLKLRDVEKGFMSSKHVFAIFNTEQRNVYKDLR
QIELACDTQEDVDSWKASFLRAGVYPEKDQPESEDAMNPSDTVSMDPQLERQVETIRNLV
DSYIGIVNKSIRDLMPKTIMHLMINSAKDFIHSELLAYLYSAGDQGSLMEESPEQAQRRD
EMLRMYHALKEALVLIGDITTTTISTPVPPPVDDHWIAKDPSPPPASRPASATAAPPSRP
PGVRGPTPGPPPPLNPSPAFGAPPVPSRPPGQAAYAGDPNSGVTPLIPSRPARVPPALPP
GIPSRRPPAAPNRPTVARPSEPSLLD
Download sequence
Identical sequences G3Q4P6
ENSGACP00000024850 69293.ENSGACP00000024850 ENSGACP00000024850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]