SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026310 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026310
Domain Number 1 Region: 125-245
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-33
Family Pleckstrin-homology domain (PH domain) 0.0000138
Further Details:      
 
Domain Number 2 Region: 2-35
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000694
Family Spectrin repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026310   Gene: ENSGACG00000019916   Transcript: ENSGACT00000026361
Sequence length 299
Comment pep:known_by_projection group:BROADS1:groupIX:20024849:20028465:1 gene:ENSGACG00000019916 transcript:ENSGACT00000026361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQSVDDVEKLIKRHEAFEKSAATWEERFSALERLTTLELLEVRRLQEEEERMRRPPSPE
PVVVLEEEPQQHSGLITQNGLPSDQDSPRDGGEKGDLLNGVCERSSKEPSPGTSPTSGRK
SKTSQSSTLPPKDQDPRPQLEGLLHRKHEWEAPNKKASNRSWHHVFCVITNHELGFYKDS
KAATQGAHYHSQAPVSLREASCDVASEYKKKKHVFKLRATDGNEFLFQAKDEEEMSTWIQ
AILNAGGDRPDPAGSGPGTPASGRAQTLPAGGDSSPGKREKDKDKDKEKRFSLFSKKKA
Download sequence
Identical sequences G3Q8U6
ENSGACP00000026310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]