SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026430 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026430
Domain Number 1 Region: 87-181
Classification Level Classification E-value
Superfamily PDZ domain-like 1.16e-29
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 9-64
Classification Level Classification E-value
Superfamily L27 domain 1.1e-21
Family L27 domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026430   Gene: ENSGACG00000020007   Transcript: ENSGACT00000026481
Sequence length 201
Comment pep:known_by_projection group:BROADS1:groupIV:31727937:31740966:1 gene:ENSGACG00000020007 transcript:ENSGACT00000026481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVVQPLSLDRDVARAIELLEKLQESGGVPGHKLQSLKKVLQSEFCTAIREVYQYMHET
ITVNGCPEYQARATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEE
MEARFEKLRTARRRQQQQILM
Download sequence
Identical sequences G3Q966
ENSGACP00000026430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]