SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026601 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026601
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000000000000981
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026601   Gene: ENSGACG00000020136   Transcript: ENSGACT00000026652
Sequence length 96
Comment pep:known_by_projection scaffold:BROADS1:scaffold_84:93841:94222:1 gene:ENSGACG00000020136 transcript:ENSGACT00000026652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVQSNIIFNGTDTLPKEVMLETTLNAFNYNYDIFEVCIEGTGFEPTIDALFGEEGFFPDT
ISKVMYWAGDKAKMLKEVLGRVAPERSRMKRQVRGF
Download sequence
Identical sequences G3Q9N6
69293.ENSGACP00000026601 ENSGACP00000026601 ENSGACP00000026601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]