SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027115 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027115
Domain Number 1 Region: 207-347
Classification Level Classification E-value
Superfamily PH domain-like 5.41e-40
Family Third domain of FERM 0.00000218
Further Details:      
 
Domain Number 2 Region: 98-206
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-37
Family Second domain of FERM 0.00000181
Further Details:      
 
Domain Number 3 Region: 11-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-24
Family First domain of FERM 0.0000152
Further Details:      
 
Domain Number 4 Region: 501-592
Classification Level Classification E-value
Superfamily Moesin tail domain 0.00000000000000119
Family Moesin tail domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027115   Gene: ENSGACG00000020507   Transcript: ENSGACT00000027167
Sequence length 593
Comment pep:known_by_projection group:BROADS1:groupVII:19308741:19313659:-1 gene:ENSGACG00000020507 transcript:ENSGACT00000027167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILGLKKKQPKTFKVKVITMDAEMEFSCEVKWKGKDLFDLVCRTVGLRETWFFGLRYTV
KDTYAWLKQEKRVLDQEVPKDSPITFHFLAKFFPEKVEEELVQEITQHLFFLQVKKQILD
EEIFCSPEASVLLASYAVQAKYGDYDPNFHKPGFLAQDELLPKRVLMQYQMTADMWEEKI
TAWYAEHRGIARDEAEMEYLKIAQDLEMYGVSYFAITQNKRDTDLLLGVDAQGLHIYNPN
SKLNPNKSFPWSGIRNISYSEKEFTIKPLDKKKEVFKFYSSQLRVNKLILQLCIGNHDLF
MRRRKVDSIEVQQMKAQAKEEKARKKMERQILAREKQMREEAERAKEDMERRLFQLQDEA
RLANDALLRSEETADLLAEKAQIAEEEAKLLAHKAAEAEQDRQRLEVTAMKTKEEKRLME
QKMREAEQLAVKLVEQSERRLKEADHLKQDLTEAKDAERRAKQKLLEITKTTYPLIAAYS
APPAPPAPPEAADTAYDSAPSRLDFKDSDMKRLSMEIERERLEYMEKSKHLQDQLKELKT
EIESLKLEEQQQQQGGVYSLRNEARGYVQEPAYAPHSNRNSAYMSQMGYFEEV
Download sequence
Identical sequences G3QB49
ENSGACP00000027115 69293.ENSGACP00000027115 ENSGACP00000027115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]