SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0146378 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0146378
Domain Number 1 Region: 94-224
Classification Level Classification E-value
Superfamily Plus3-like 7.98e-36
Family Plus3 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0146378   Gene: FBgn0119951   Transcript: FBtr0147886
Sequence length 295
Comment type=protein; loc=scaffold_15203:2198621..2199508; ID=FBpp0146378; name=DgriGH12472-PA; parent=FBgn0119951,FBtr0147886; dbxref=GB_protein:EDV99696,FlyBase:FBpp0146378,FlyBase_Annotation_IDs:GH12472-PA,REFSEQ:XP_001991072,FlyMine:FBpp0146378; MD5=81089c83311d42e2cff9c5b5ddbbe03f; length=295; release=r1.3; species=Dgri;
Sequence
MSKANRRQGHSSNLKSSLPRSDRMDFDLPQFMQPLSRKVPPNEPQLRRRPKWEIVRELRH
LRAQGSSDDNDADDKMATLGILGTLTTSGQPVQTLDQLDALRLTRHRIEQLLHSSSRFDQ
AVQSCFVRVNINGANVPPEHRMAQIFNVAELPLGYYVGKTATNIVLHLRYENLCVSHELN
DISNMAFTREEFDFWHDNCICQGIDWPTMELVARKKIELYNAFNSELKIGSMLRQKALLG
FSMPMRPVPKGELLQRLGGGVYPWKLQRPAKEGEEAAAAAAAGAQTDKLEQGEHP
Download sequence
Identical sequences B4JJE4
XP_001991072.1.65300 7222.FBpp0146378 FBpp0146378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]