SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0152310 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0152310
Domain Number 1 Region: 6-255
Classification Level Classification E-value
Superfamily CutC-like 3.27e-58
Family CutC-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0152310   Gene: FBgn0125872   Transcript: FBtr0153818
Sequence length 260
Comment type=protein; loc=scaffold_14906:complement(6103522..6104304); ID=FBpp0152310; name=DgriGH18404-PA; parent=FBgn0125872,FBtr0153818; dbxref=GB_protein:EDV93192,FlyBase:FBpp0152310,FlyBase_Annotation_IDs:GH18404-PA,REFSEQ:XP_001990130,FlyMine:FBpp0152310; MD5=611f6053e503c9bcc97da530fffc3a85; length=260; release=r1.3; species=Dgri;
Sequence
MSSHEIKLEVCVDSIKSALAAEEGGAARIELCAALQEGGLTPTTGTLKTLKELPLALPIC
CMLRPRRGTDFVYSEEELQATLTDMDLLRTHGADGFVFGALTPERTIDVDKCRRVMEHSY
GLPVTFHRAFDLTDHKFMHENVELLKELGFKRILSSGFRSSAAEGVDYLAQLIAKHHRDI
IIMPGAGIKVSNLEEILTVSRCLEFHASALDTASEDYSAPTTTRMDCDVTMGKQDIDPYY
GTNVNVVRKMVTIASAMSCR
Download sequence
Identical sequences B4JER1
FBpp0152310 7222.FBpp0152310 XP_001990130.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]