SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0155266 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0155266
Domain Number 1 Region: 450-579
Classification Level Classification E-value
Superfamily Plus3-like 3.4e-43
Family Plus3 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0155266   Gene: FBgn0128822   Transcript: FBtr0156774
Sequence length 796
Comment type=protein; loc=scaffold_15245:join(6794778..6794858,6794994..6796011,6796081..6797265,6797329..6797435); ID=FBpp0155266; name=DgriGH21360-PA; parent=FBgn0128822,FBtr0156774; dbxref=GB_protein:EDW01292,FlyBase:FBpp0155266,FlyBase_Annotation_IDs:GH21360-PA,REFSEQ:XP_001986425,FlyMine:FBpp0155266; MD5=aba98a08e100355708270984d4c00b9b; length=796; release=r1.3; species=Dgri;
Sequence
MGKRRTQSLMDSNSSNSDSDTDTNLESDLLSVARKRKKPSNVTKATNSKSDSDSDWANNK
SGAPASKKKRQKKTSRDSSSSEENWDDDSQDEAAPTNAPAPIEKRPEPELHKKADNHSEQ
EEGEVSDSDSDNDKSKSKSTSSSGSGSGSGTDSSDSSSSSSDSEFDDGYDDDLMGDEADR
KRLNGLSEKERETEIFKRIEQRDIMRTRWEIERKLKLARRGEKNEKSKTKGDRAKKKSKK
EKRLKRAKELVAPTMHQASVGADTDPSKSGAVEPRTMAKSPSPPLTSMREGPSTSMASSG
SGGGAPRSSSAERIAEEQRASDVADYFDHKERSKERKKNVEANKTDDKRSNAMAMLKAKR
EGKAKREEEEAKRQAERDRDDDKEELESVSGCKSAVKLKASEIYSDDSGSSDWDDDEKPT
DKRSRSNSSKASSESEDDDKATKDPVFITTREDLNKLRLSRFKMERFVNLPIFESTVVNC
FVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRTNRGLRLKHGTQERVFRLEFISNQ
EFTETEFNKWVDICQQSHVPMPTIDLIEIKANDIKKALNYEYKDEDVDKIVEEKNRFRNR
PTNYAMKKTCLMKERDAAMLRGDYDIANDLGQQIDQLESRASELDKRRSHSLNLISYIND
RNRKRNVQDAEKAIMEEARANKGQKISDPFTRRITQPRMGFKGGVKKDDEDMLLAPMPPP
PPGKKKANETSTSNNAKPSDGKDYSLYSLHDFDIDLDVPLPVNSANALPKPANKPTETVS
KRSLNLEDYKKKRGLI
Download sequence
Identical sequences B4J8M5
XP_001986425.1.65300 FBpp0155266 7222.FBpp0155266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]