SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0158185 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0158185
Domain Number 1 Region: 95-207
Classification Level Classification E-value
Superfamily Plus3-like 9.68e-26
Family Plus3 0.00096
Further Details:      
 
Weak hits

Sequence:  FBpp0158185
Domain Number - Region: 22-82
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00112
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0158185   Gene: FBgn0131735   Transcript: FBtr0159693
Sequence length 342
Comment type=protein; loc=scaffold_14853:complement(3945990..3947018); ID=FBpp0158185; name=DgriGH24279-PA; parent=FBgn0131735,FBtr0159693; dbxref=FlyBase:FBpp0158185,FlyBase_Annotation_IDs:GH24279-PA,GB_protein:EDV92013,REFSEQ:XP_001992306,FlyMine:FBpp0158185; MD5=58c523f1513c5fe2b18c552a4d583630; length=342; release=r1.3; species=Dgri;
Sequence
MGSTEDYKWRKRICHKWQEELQQQDQQRQQHLQLQEHKQQQQQQQQQQQHLRLHHQQLQQ
RHQQQQKHASQVEQQLAQQSLMCRRFSNFVDDPLNLRKLFLSRRTLKMLTQLPNFECLVK
ACFVRVRFGVGHRVAQIMGFSKWRPSSEPPLILRIDSNPRVFCLDQLSNSYFDAAELLHW
KHVWQVNNFELPSRSFVEKKYKTISEAKQSVLGQPQHANSYITHKLAQERKSLVHGYPTT
QQLHQQLHGSQRNICNMLPQRIEGATISHATPTGIYLVKPFERYKPYPATAEFKSAVNCQ
IPTAPIPVASKQMDLKRQPNSECSKKKISLDEYRKRIAMKNK
Download sequence
Identical sequences B4JMS0
FBpp0158185 XP_001992306.1.65300 7222.FBpp0158185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]