SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0144760 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0144760
Domain Number 1 Region: 205-495
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.88e-97
Family Cryptochrome/photolyase FAD-binding domain 0.00000624
Further Details:      
 
Domain Number 2 Region: 7-218
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.79e-47
Family Cryptochrome/photolyase, N-terminal domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0144760   Gene: FBgn0118335   Transcript: FBtr0146268
Sequence length 538
Comment type=protein; loc=scaffold_15252:complement(232585..233552,233610..234258); ID=FBpp0144760; name=DgriGH10854-PA; parent=FBgn0118335,FBtr0146268; dbxref=GB_protein:EDW02770,FlyBase:FBpp0144760,FlyBase_Annotation_IDs:GH10854-PA,REFSEQ:XP_001987903,FlyMine:FBpp0144760; MD5=9cc95a79959fc42a05047263f64a9064; length=538; release=r1.3; species=Dgri;
Sequence
MTAQRRTLVHWFRKGLRVHDNPALFQIFEVARAAPEKFYVRPIFILDPGILDWMQVGANR
WRFLQQSLSDLDQQLRALNTRLFVVRGKPVDIFPGLFERWQVQLLTYETDIEPYAVLRDA
AVQQLAASQGVKVDTHCSHTIYNPELVIVRNLGKPPITYQKFLGIVEKLKLPKVLNKPKK
LPDGMQPLADSDIYDYPTLEQLVKRPEDLGINKFPGGESEALRRMEASLADEQWVAKFEK
PKTAPNSLEPSTTVLSPYLKFGCLSARLFHERLQEILARQPKHSKPPVSLVGQLLWREFY
YTVAAAEPNFDRMLGNAYCLQIPWQEQPEHLEAWAHGRTGYPFIDAIMRQLRQEGWIHHL
ARHAVACFLTRGDLWISWEEGQRVFEQLLLDQDWALNAGNWMWLSASAFFHQYFRVYSPV
AFGKKTDPKGDYIKKYVPELAKYPAKCIYEPWKATLGEQRDYGCVLGSDYPHRIVNHDVV
HKENIKRMSDAYKVNREVRTGKQEEGHEEEEEYEEHPTGKRKASSKVTGSKLKHKLLK
Download sequence
Identical sequences B4JAI4
7222.FBpp0144760 XP_001987903.1.65300 FBpp0144760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]