SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0150069 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0150069
Domain Number 1 Region: 505-598
Classification Level Classification E-value
Superfamily TAFH domain-like 7.85e-33
Family TAFH domain-like 0.00032
Further Details:      
 
Domain Number 2 Region: 931-980
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000628
Family TBP-associated factors, TAFs 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0150069   Gene: FBgn0123634   Transcript: FBtr0151577
Sequence length 1141
Comment type=protein; loc=scaffold_15110:join(6718543..6718851,6719952..6720116,6720405..6721142,6721953..6722450,6722521..6722634,6722693..6722908,6722967..6723893,6723954..6724127,6724203..6724328,6724415..6724573); ID=FBpp0150069; name=DgriGH16163-PA; parent=FBgn0123634,FBtr0151577; dbxref=GB_protein:EDV96276,FlyBase:FBpp0150069,FlyBase_Annotation_IDs:GH16163-PA,REFSEQ:XP_001983928,FlyMine:FBpp0150069; MD5=2a2ba4900292d82707734a552e0586de; length=1141; release=r1.3; species=Dgri;
Sequence
MNSSQTAPTATSATSNRITFTTQPLPNGTINIGGPGGGGVGGPTIISTAQLPNTTTIKTI
TAGMGGHGVPGLSQVHHQVQHQQQQQSHPQQHQQHQHQHQTQSSGQPLLNSMLPAGVVVG
MRPQAPTQQQPKNMPANPLSRVVISNSHMAGVRPQSPSINLGTLHTGQTPALLVKTDNGF
QLLRVGTATTSGPPTMTQTISNTSNNNNNNTNNNNTTTTTTNHPITTQIRLQTVPAAAVS
RYHGQSSSQQLQQQQQQQQSQQLQQQQKQQQQQHQTTTQASSQATTASTSIALRKTIVRT
SSTILPSSNNNNNNNNNINNTTTTTNNNTTTITNNNNNKPATNLQHQQQQQQKLQLQLKQ
QQQAQQQHKQQQQQQASVSASSAAAAAAAAAAANVAATIKIKQNSMTNTTASSNIIVNSV
ASTNAHSYSTATQPPHLAQLQHQQQAPHLPQVTQIQTIPAQGQGQHQQQQQHSQANHVQV
ATAAASVTAAANANATTTTTAAQGNTKEKCRKFLANLIELSTREPKQVEKNVRTLIQELV
NATVEPEEFCDRLERLLNASPQPCLIGFLKKSLPLLRQALYTKELIIEGIKPPPQHVLGL
AGLPPQLPKIQAQIRPIGLTQTTTIGQTQVRMITPNAIGTPRPTIGHTTISKQPPNIRLP
TAPRLAIRGQMPSLPMPAQANIVQIRGPTNAQLQRTGAVQIRATPRPPNSTPTNKVTAVK
VGQTQIKAITPSLHPPSLAAISSNSGPPPTPTLSVLSTINSASTTSLPVPSLPTVHLPPE
ALRAREQMQNSLHHNNNNHFEPKLVEIKAPQMQHIERINASLTPISAKTMPRGAFPMPNK
SVTKKKRDALDRDGKDEKVNSGSGTAGSTAAAAAAANSFFQQSSMSSSIYGDDDINDVAA
MGGVNLAEESQRILGCTENIGTQIRSCKDEVFLNMPALLARLRTISAERGLEEPSQDVAV
LISHACQERLKNVVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEE
LEREMLLRAAKSRTRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKLKL
DSDTASAGVGSSGGGLLSNTGTTTTTLRPRIKRVNLRDMLFFMEQEREFCRSTLLLKTYL
K
Download sequence
Identical sequences B4IWQ0
XP_001983928.1.65300 FBpp0150069 7222.FBpp0150069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]