SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0152763 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0152763
Domain Number 1 Region: 555-749
Classification Level Classification E-value
Superfamily Tropomyosin 1.74e-57
Family Tropomyosin 0.00000108
Further Details:      
 
Domain Number 2 Region: 738-814
Classification Level Classification E-value
Superfamily Tropomyosin 2.62e-18
Family Tropomyosin 0.00036
Further Details:      
 
Weak hits

Sequence:  FBpp0152763
Domain Number - Region: 954-979
Classification Level Classification E-value
Superfamily Tropomyosin 0.000196
Family Tropomyosin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0152763   Gene: FBgn0126324   Transcript: FBtr0154271
Sequence length 983
Comment type=protein; loc=scaffold_14906:join(874721..875150,875455..876638,879518..879679,883199..883332,884829..884946,888131..888201,889534..889609,889814..889876,890492..890554,892140..892209,894355..894849,896488..896573); ID=FBpp0152763; name=DgriGH18857-PA; parent=FBgn0126324,FBtr0154271; dbxref=GB_protein:EDV92603,FlyBase:FBpp0152763,FlyBase_Annotation_IDs:GH18857-PA,REFSEQ:XP_001989541,FlyMine:FBpp0152763; MD5=af823427eab70b0cef70d62951fd3227; length=983; release=r1.3; species=Dgri;
Sequence
MYEKTLTIGNAKVNNAYEWQKVSYTKNQAPAFKTRQKPNNNNNKKTATIPKTVENCAKNA
TKTQVDHSKLKPATKTAITKTTATPTLTAFKPATQTPLIKKYVGNAARRQTLAHQIKRAH
RHLLTSGGNDKQPQKQQLNNKQTRQQPTKTTKATKQQRNKRSINANKQLHCRKSDTQKKK
QQRSTSDSQKSGLSSRWCSIEEQLNVLDQLLHYDEQSEQYLAKLYDNYQQQQQLDTDSDS
WSCGSDYDLNIMSHNNNNNSADDDALSSTSGAGSHSTKNSTSPLVPASLKRRGHQHHPRF
AGTRRPNVPNVQEILAALYRGDSKGVLSNLRGEVHPETERDSEPGVNRSTLSLPLSESLT
NSVGSNSPTPTDESSMMDDTTTTTATAIPAAAADATDAAPTIKKKKKRDKGDKEKSERKK
KSTASSGKRERSKRSAAGGIMELSSDSLATDLSAGAIDEGIVVNTEDEDTQAHEWSKLRC
TSEAAEIVAEREARRNKGRCADYPGLAFGRSIFSSDTMMKFNIIRNELHNIMNTQLKRNK
QSTKMTTSIPQGTLLDVLKKKMRQTKEEMEKYKDECEEFHKRLQLEVVRREEAESEVAAL
NRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQL
KEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLE
VSEEKANQREEEYKNQIKTLNTRLKEATQKEETLDTQIKVLDHSLKEAEARAEFAERSVQ
KLQKEVDRLEDEMINEKEHYAIINDSLDFTFVELMGMPPFYNDRHPKPPTPEPTEAEIAA
KEAQIRAEIADEAVQLAAEGEEPAADEEAGDFAAETVEVAPAEPVKEPTPPPPPFDYNID
LPPEGAEVPYVKNFEAGDAPPAADVPAEAAPAAEGASVAEGAPGAEGATAAEGVPDDLVL
EKERYKDIGDDLDTAFVELILKE
Download sequence
Identical sequences B4JGD4
7222.FBpp0152763 XP_001989541.1.65300 FBpp0152763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]