SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0156247 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0156247
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-29
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily L27 domain 2.94e-21
Family L27 domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0156247   Gene: FBgn0129799   Transcript: FBtr0157755
Sequence length 195
Comment type=protein; loc=scaffold_15116:complement(385900..386049,386516..386649,387831..388097,388161..388197); ID=FBpp0156247; name=DgriGH22341-PA; parent=FBgn0129799,FBtr0157755; dbxref=GB_protein:EDV98555,FlyBase:FBpp0156247,FlyBase_Annotation_IDs:GH22341-PA,REFSEQ:XP_001996194,FlyMine:FBpp0156247; MD5=c66dde9c70be671e6325c00c7daefe01; length=195; release=r1.3; species=Dgri;
Sequence
MTEISEPLTLARDVKRSIELLEKLQSSGDFPTTKLAALQKVLSSDFLNSVREVYEHVFET
VDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHERAVELLKQAVGSVKLVVRYTPKVLEE
MEMRFDKQRNTRRRQ
Download sequence
Identical sequences B4JYU0
XP_001996194.1.65300 FBpp0156247 7222.FBpp0156247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]