SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0156670 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0156670
Domain Number 1 Region: 1021-1130
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-25
Family PDZ domain 0.00015
Further Details:      
 
Domain Number 2 Region: 268-358
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-24
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 386-480
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.21e-20
Family FHA domain 0.00042
Further Details:      
 
Domain Number 4 Region: 40-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.25e-18
Family Ras-binding domain, RBD 0.0095
Further Details:      
 
Weak hits

Sequence:  FBpp0156670
Domain Number - Region: 544-593
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.068
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0156670   Gene: FBgn0130221   Transcript: FBtr0158178
Sequence length 1280
Comment type=protein; loc=scaffold_15074:join(4447545..4447649,4447749..4447857,4448659..4448852,4448918..4449469,4450211..4450292,4467613..4467965,4471142..4471263,4472304..4472358,4472453..4472754,4473101..4473307,4474327..4474792,4474912..4475436,4475893..4476140,4476828..4476946,4480615..4480896,4481030..4481151); ID=FBpp0156670; name=DgriGH22764-PA; parent=FBgn0130221,FBtr0158178; dbxref=FlyBase:FBpp0156670,FlyBase_Annotation_IDs:GH22764-PA,GB_protein:EDV94792,REFSEQ:XP_001994056,FlyMine:FBpp0156670; MD5=9a69574cf0a88dea665688a0cb50ae07; length=1280; release=r1.3; species=Dgri;
Sequence
MSHDKKMLDREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIR
VASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHID
DREGRFLLKNIDQKTTPIEQSDLNFKRKLSKREKKEQKKKEKMAKLSSDLPNLANGSQLG
LGNGVGGSGASASAAHMNGSAGGNGGIGGNNGVNSSDAVAGKLYTELPETSFTRSISNPE
AVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVR
EMLTKYGLEKADPLHYCLVQVNSDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRRPAD
SQPRRRKKKPLGAANGANHMSGDREGPVLVEVTHSGDGGRRIKLGSDPVEVGSANTNCLQ
LFGPSIQPRHCLISLHEGVCTVTPLHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRF
LDSPTDGRYNLALSQSQLDSACLYESRSPTSPGSWNDEDGALSSTQKSEYEQHQQLNQSS
GGFHNNTTETQALNSMRDAVDSKHCGGSQEQQQQQQQQQQQQQQQQQQQQQATSNYDGQS
LEGNLENEIKSISSMKSNGSNSQDRSPKLPGSSGLLSGAGGSGDGQGQEPILPAVLEFPE
THQEHFLRHIISELDVNVPHFKLAPVYSLYLCARYRASTHYRPELQPTERAHKLTIFLHH
VANLVYGVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSVQAQEVLAEAVQTAFRN
LVNCFRLELSQTLNQFLSETIDHDSAAGLVLTVLGSAMALLRRCRVNAALTIQLFSQLFH
YINVICFNTIVANSHMCTGEWGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQ
APKSSVEEIQQLACSCFRLNSLQMGALLQQEKIPRNLVDTAIRMAESVADELTRADGREV
RLEESPELHLALLLPDDGFSCDVVRGIPTGLVDFLNPLQQQGMCRLAAQPTSIGLWTVYM
HQFNARSSSSMSNKLPQPEMQLIKLHKNSNGMGLSIVAAKGAGQERLGIYIKSVVPGGAA
DADGRLQAGDQLLRVDGQSLIGITQERAADYLVRTGPVVSLEVAKQGAIYHGLATLLQQP
SPVIQRGNRRMSERDLSRMGGAESSKSLGVLGGPLIANSHTSHSLNQHLNLSNSNINNSH
SNNSNNINSISSNIMNPLAAHLPNSKSVPALHHHTGSGNISLANSKSRSTHSLHNNAGGG
IVGVNQMAVATIQIQIQMQI
Download sequence
Identical sequences B4JSQ2
7222.FBpp0156670 XP_001994056.1.65300 FBpp0156670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]