SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0131270 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0131270
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000366
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00087
Further Details:      
 
Domain Number 2 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.0000000000000126
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0131270   Gene: FBgn0105011   Transcript: FBtr0132778
Sequence length 104
Comment type=protein; loc=scaffold_4644:complement(885437..885679,885739..885810); ID=FBpp0131270; name=Dere\GG12724-PA; parent=FBgn0105011,FBtr0132778; dbxref=FlyBase:FBpp0131270,FlyBase_Annotation_IDs:GG12724-PA,GB_protein:EDV45425,REFSEQ:XP_001982456,FlyMine:FBpp0131270; MD5=4b34a7a3c3c6de26c816dcf8dd12be03; length=104; release=r1.3; species=Dere;
Sequence
MTYQHYRATTLGTTLQETLDEMIQSGDITEDMASVVLRKYDKSVTKALDEHVTSKINFTA
GRLENYRFCDNVWTLLLKDVEFRQGQEVLQVDAVKVVACLGKRD
Download sequence
Identical sequences B3P9C9
FBpp0131270 XP_001982456.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]