SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0139109 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0139109
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 4.71e-60
Family CutC-like 0.0000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0139109   Gene: FBgn0112753   Transcript: FBtr0140617
Sequence length 259
Comment type=protein; loc=scaffold_4770:complement(10722502..10723281); ID=FBpp0139109; name=Dere\GG20563-PA; parent=FBgn0112753,FBtr0140617; dbxref=FlyBase:FBpp0139109,FlyBase_Annotation_IDs:GG20563-PA,GB_protein:EDV49014,REFSEQ:XP_001980056,FlyMine:FBpp0139109; MD5=4073864e9ad8cff34b8fc0ffc6f48464; length=259; release=r1.3; species=Dere;
Sequence
MSSHEIKLEVCVDSIRSAFAAEAGGASRIELCSALGEGGLTPSIGTLKTLKETLTIPIYC
MLRPRRGTDFVYSDEEMCALLTDMDLLRENGADGFVFGSLNPDRSINVDQCRHVLLASGG
LPVTFHRAFDLTDQKSMDENVHLLRELGFRRLLSSGFRPTAADGVDCLAQLIAKHQRDFI
VMPGAGIKVSNLEEILTVSRCLEFHASAQDTAGEDYVAPTTTRMECDVTMGKQDVDPYYG
TNSNVVRKMVTIAKAMSSR
Download sequence
Identical sequences B3P0W6
FBpp0139109 XP_001980056.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]