SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0140729 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0140729
Domain Number 1 Region: 431-560
Classification Level Classification E-value
Superfamily Plus3-like 1.28e-41
Family Plus3 0.00000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0140729   Gene: FBgn0114357   Transcript: FBtr0142237
Sequence length 776
Comment type=protein; loc=scaffold_4845:join(12402941..12403021,12403133..12404093,12404158..12405342,12405401..12405504); ID=FBpp0140729; name=Dere\GG22183-PA; parent=FBgn0114357,FBtr0142237; dbxref=FlyBase:FBpp0140729,FlyBase_Annotation_IDs:GG22183-PA,GB_protein:EDV55591,REFSEQ:XP_001975191,FlyMine:FBpp0140729; MD5=f210e288e8a729a9ec4aeade847f4f19; length=776; release=r1.3; species=Dere;
Sequence
MGKRRTQSLIDSNSSDSDSESETNLESDLMSLAKKRKKPQTAAKSSSRSDSDSDWANNKA
GAPATKKKKRQKASRDSSSSESNWDDDSQDEGQPARQSPAQAQQENKPPEQAIQAAQLSE
QEEGEVSDSDSDKSKSNSSSSGSDSSSSSSSSSDSEFDDGFDDDLMGDDEDRRRLNGLSE
KERETEIYKRIEQREIMRTRWEIERKLKLARRGEKNQEKSKNKGERAKKKKEKREKKARK
AREAQAPLPTQASTSTLLDVEPKPSNEVRSASPLSSPALNRDAASTSAAVASIMPDDQAS
AAGVSDYFDHKERSKERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEEAKRLAEKDR
DDDKEELESVSGCKSAVKLKASEIYSDDSGSSDWDEDEKPTGKRSRSNSSKASSESEDEE
KVPQRPVFITTREDLNKLRLSRYKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAE
IVGVVETGKIYSLGTTRTNRGLRLKHGTQERVFRLEFISNQEFTENEFNKWNEVCQQSHV
QMPSIDLIAIKQNDIKKALNYEFKDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKERDAAM
LRGDYDIAQDLGQQIDELENRASELDKRRSHTLNLISYINDRNRKKNVEDAEKAILEEAR
ANKGLKISDPFTRRITQPRMGFKGAKKDEDDVQLAPLPPPPPGKKRPNEAGTSSASVKPT
DSKDYSLYSLHDFDIDLDVPLPVNTNSVPKPANKPAETVSKRSLNLEDYKKKRGLI
Download sequence
Identical sequences B3NNN4
XP_001975191.1.56816 FBpp0140729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]