SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0128591 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0128591
Domain Number 1 Region: 283-376,436-713
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.8e-80
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0093
Further Details:      
 
Domain Number 2 Region: 22-291
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 6.28e-39
Family Lipovitellin-phosvitin complex, superhelical domain 0.0005
Further Details:      
 
Weak hits

Sequence:  FBpp0128591
Domain Number - Region: 3685-3809
Classification Level Classification E-value
Superfamily vWA-like 0.00812
Family Integrin A (or I) domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0128591   Gene: FBgn0102357   Transcript: FBtr0130099
Sequence length 3951
Comment type=protein; loc=scaffold_4929:join(10248133..10248200,10250456..10252997,10253057..10253397,10253452..10253662,10253727..10254085,10254144..10256106,10256165..10256323,10256381..10257927,10257983..10258607,10258664..10260932,10260988..10261157,10261211..10261297,10261365..10261924,10261988..10262188,10262256..10262946,10263025..10263087); ID=FBpp0128591; name=Dere\GG10045-PA; parent=FBgn0102357,FBtr0130099; dbxref=FlyBase:FBpp0128591,FlyBase_Annotation_IDs:GG10045-PA,GB_protein:EDV58387,REFSEQ:XP_001969328,FlyMine:FBpp0128591; MD5=c83af130153a13721f5980c1a6507dbd; length=3951; release=r1.3; species=Dere;
Sequence
MALDGMCAASKDTAPNPKQNALENHLLESLPFIGSTASYKVMRDQIINEKLTKQMAHDWM
TALSFITRPDEETLETFHSILDYAKNRLDAEYTLGATAVVHSFCKHHEACEENLRVQQII
NLLETEFLNLYNLFKGERRTRERMIILLKGLGNVGVLSPAFAEQLQWIIREDEAPVDIRL
HGILAFRRVDCARHRSYFLDNYGNYTLNSELRIYSYLQAMRCPDYISVGVIKSILEHEQI
NQVGSFVWSHLTNLAKSNSPVRIEAQGLLLNDELSDRFKMDIRKFSRNYEHSLFFDEYNF
GTTTDANVIFGTDSYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGILS
GQVLRKKLSFLNRWLGTESAEEDDTLENLLSLDNLRLKRKAQPHARVSEEEEVEDYDFEE
SLEGNERHKRDVSTARKQDIDRNVDNLGYKLKYDYNNPRAQFGLRVFGNDLRYYNVESLV
EVMALAAKFNPFQQAKNVLSGKEFTYTKSRVFLDASYTVPLAVGLPLAIHAFGASSIDLR
VSGNLDEMDPPTDWHFDVEGQFRPSVSVDVITTMQTDMFWEQSGIKVKSNLYSNSELVAK
LKVRGRNLVSFSFDLPRDQNEIFSVRSELLVQKQQEQLPQAGIAKRSANSTCTWPVLDQA
IGLQMCSHYSVPDLSNATEIYPSLLLAGPLNFSLILKKSDLSAKKYVFEYKWDQREEDNK
FSLVFTTPGSKVPRVLVANVTKVPDAFNASVAFVNGPSRVSAGCSYDGNPEFRRLDVYLD
TNGNRSLDLGMELRRHQDFTAWIYNPRMLLAINGVNITGMAGTVKVNEKNGIKQHDVDLS
FETKKLQAVIKGNVVQNEITTSTNMTIKYRFQANKIEEINFAGKLVNTGDKSKTEYRGNM
KLQTSAYPKLNFASESMWLSLQGHTEGMITYNNAPDYVNPNYTSLVRFIFARNTEDSLPD
LPSTRASLELKLPRSKIDYRILVKHEERFKNGTEHKVTVGLKYAPEKEITGLFSVHMPRR
NLFAIDAYMNVAVPEFNSCTARLKVNEKATKDYIIFINGSWFTGHSVTVKANYKDRSSRV
QALHHMKMIVESPSFNVTSLNIVYRRKQFLIFYDVQAKYGQDPYGLTMQYASIAHNRNSN
AELRLKIKERDYWINAKLLSEQPKLLQLEIHMDKVRDVHIQVGLLNVDKRKELSLELKWD
ANRDPSQRLGLLAEYNSPGTKHYDGNVMITYPERTINLGFNSFTGGPKYHGKVHASWSIN
DLIEFEYEAGILPGHTLHNWVKAELRTPFEGWRVNSLDAGIYNLNNLILINSTLFWADDQ
KLQVGYKSDYDVNDRLLSFDVRFGINSTIQDIPTINVKVKHWMDVKKVDTELYLGYSGQN
DTFNTYSMDSSWEIEKNQRYNNYSGLVHLVSPFKGYEKGGLVAQFSLSDQRVVSGAASLN
FDLREFTLTMDGYVKKFTDNMLTVNITTPLEKFRTINARLGLNEKKRHAVAEVRAPTAAL
GVEVLADVRNLLNFDVKLSVATPIESFQQAAVFALFHPERVDMRGLWNNATLGFTGVWHM
ENVTDFEYSYHVFTPLAGFEENGFIVQLLKRDQFVFQLHGKMSNYKLGVKINGKPKSDLV
NQLGGNKMELEMLYDADFKPLNAETDYKPDPDEEYFSYFTDFQVDTLVWPTIVGNVDIQE
IIDFYLVVGHVELPQGKMEFKDRLHYPDYINVHNLLTVTTPFAVAKNVKSILEYHVDLQF
NAFYERVKFIVTDDKDHTQELGFEFNYTALQDNVKPKAHDVQITLLTPYEMLHEIYVHGR
LDLDDNAYKGNISAVTAKTHLSMAASIENEDNFLETSVGILLETDVIPHYGCQVYFKKDY
SAVDKAIDIRFEVTDNGTLNQLHVATDWHTDPSYIVNANGRIKTTMLPLQMASSSVLITQ
GQNPQLNFDLNFMSQNGQSISYGTRANKKKDVFNIEVWTPMKNFRNISMHGTVVRNARDA
GRYDVSGFLYRNMATYGVTGAVRMTNSLPIDVVLRVQPKTGGRDGVIELNIHEAGPKKIR
FSFSAIEDGKMCQMSGGYSVSESNEAMDFSVLVESTEPEIARINFYGNLSPNSEGSLVGD
LHLETPWKSLGIDTVHLHSDVGFLSTGGHIVGEYKIGQYIGRGSCLWSWVLAENMQLVLE
NYLERPNAKPRIVHASAKYQNPGQTYAQMQAGGRLSVDSKWNLDVNGSAQYKSADDFQFS
VITELPLPVGDRHQLSASYKGNVISQQFNNPDFAFEASYESLEAQNKLLSRVSYQNATNN
HRGLGHVEWGKLQGLYVVEGDFELLQKQGAQKQFSAKMITPKFKNEHTFAITGSYDLEKS
GYHKVVGALDYPSSRRITDLDVSFSSLSNTHGIFNSTLPTFFNVSWLKTDFNFSTNNGKS
YRYCRCFWPQDTAYFKLNSNYDSDSNNLSHNVNGNVEVEVPLATRHRADVVYGLQKRRNQ
DAGNVKVVYNEKQVLDGKYKRVDQAKHPIYKETTDISLENEVKPLGIHFVSTRDASDPAG
TQDVKHIEVYELRNTQNFNLTGELHSRSTLKAQDFKVVAIHPNRAVVLSTKYEDVSPEVV
RHHTKLELSETAWIGYNLELGNFSKLGNESQSFALEIFYPKRNLSSSGQYYMTDTHFNSD
LSFQWLGGNYNQQPKTIHSNLQWKAEPLRRGDREHRTIALTVAHPLLEKDINCKATYYRG
LHDLLRTHLTIDYSEYPDQLIELGAQLTDRYSELGHTNYTFQVYGKHVASELDVQLNGTL
AARNSYYKTESTAHYKRDIFPARYGKFLALLDVNRREVEYERQSPFHTVRLHLLPTIRYP
VYGLNATIWDTPDTNQSGYIYMDILERYARMDFNLTEDASQNLQMVGYIPDTRSAFLDIW
RNYEEIRVIDVSSYLKMNHSRLITGRFHWRPSIQQEVRDKIQAVGKSVYSSFSEGIDFWV
KSIYTETTESMGVVWNTAKEYNRDFIDDIGQLSVLEEDLADLRLFVNQSYEANDFYIKNV
VNFTLTILDELAIRDHIESLPKIFSELWQAMGDSGKALRNSIVWLIDTIKTTYNNLLDAV
ARFFHGESLVYISGLLEKGIAKYDSFVKDLHIKFITYIEHLWHKTWTSAENHWKAVLKRF
EPHLFKMISFIETTAWNLSKEVFDFIYKRTNELAESPYFNKVSSFTADAERLYRDFKSND
AITNIKKYSTLAWNFVKEKYFKLVPFGAELNEILTEIWQEIKELEKIDQVQIMVQKYYEV
MAKVDWVADELQLEHRLHQVYGLVRNKFRNYAMNALETADMYREAKTKFVFDPEVGIIDL
EQKLPMSWHAFTETPRFEEIPEYQVLAKAQSFFSETNSSIVMKLYNMRTHLDPKTWLPPY
YSRALLIDSRHYMTFDQRYVGLNLNFDEFGSGRPTSQCSYLLAHDFFKRNFTLLLEPASK
SLAGQGLTRNLSFIANGQLIEIDLETDHISINGNPQPVLPLKLGDVNIHRDLDVLSITSD
TEFSLHCNVQFDICWFEVSGWYFGRTAGLLGTLNNEPYDEYTMSSGAISNETQRFTDSWS
LKQCRQNKLAKSQEVSKEVGAACTSFFSSGILATCSAVLDPAPFYEMCLDLGMKSPPIRK
GHPAVKGACAAALAYIEACTALKVPMRVPSQCVFCQLANGSYVPEGTFMELSGPEIPRSS
DVVFIVEAKECNDNLKTSKSIMTVVSSIEEQLQAAKLTNNRYAVVAFGGVAPYDKPRSVI
YEHNEFTFKPEQLADYFGHINTGNGSSNDILMAISAAAKLNFRPGVSKTFILLSCTKCAA
RDMRFDYSSILQYLLEEGINLHILADTEFDFERTKKLRHFFGLDSKLVYSKRFPEGDAET
RSTTHIPKSNLGICTTLAVETHGSVFSARKLQPERKYPIKRLATIFAKRVALSATPIQSQ
TCECSAHNTGVSYMACSPQALPEEKYDLDDYDSFNNWDWGDELESEPNVTS
Download sequence
Identical sequences FBpp0128591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]