SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0129735 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0129735
Domain Number 1 Region: 992-1100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-24
Family PDZ domain 0.00014
Further Details:      
 
Domain Number 2 Region: 257-347
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.41e-24
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 375-469
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.63e-20
Family FHA domain 0.00039
Further Details:      
 
Domain Number 4 Region: 40-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.76e-18
Family Ras-binding domain, RBD 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0129735   Gene: FBgn0103490   Transcript: FBtr0131243
Sequence length 2035
Comment type=protein; loc=scaffold_4770:complement(1274226..1274418,1274483..1274604,1274681..1275942,1275985..1276700,1277829..1278045,1278171..1278419,1281609..1281727,1281787..1282034,1282099..1282623,1283570..1284035,1284951..1285157,1285459..1285703,1285764..1285818,1286603..1286724,1288472..1288824,1303278..1303359,1303723..1304241,1304316..1304509,1304732..1304840,1304901..1305005); ID=FBpp0129735; name=Dere\GG11189-PA; parent=FBgn0103490,FBtr0131243; dbxref=FlyBase:FBpp0129735,FlyBase_Annotation_IDs:GG11189-PA,GB_protein:EDV47846,REFSEQ:XP_001978888,FlyMine:FBpp0129735; MD5=e196c674fe4c32c94bb96998621f6ff3; length=2035; release=r1.3; species=Dere;
Sequence
MSHDKKMLDREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIR
VASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHID
DREGRFLLKNIDQKTTPIEQTDLNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGL
GNGVGASSGSAHMNGNAGESGGDGSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKL
EKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLAKYGLEKA
DPLHYCLVQVNSDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRRKKKPL
GAANGANHISGDREGPVLVEVTHSGDGGRRIKLGSDPVEVGSANTNCLQLFGPSIQPRHC
LISLLEGVCTVTPLHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRFLDSPTDGRYNL
ALSQSQLDSACLYESRSPTSPGSWNDEDGALSSTHKSDYDHHQQANHSSAYHNNNNNSSD
HHLSSTLRDVVDSKAGQDQGASSGNYDGQSLEGNLENETKSISSLKSGGSNSQDRSPKMT
GSGILAGGGSGSGDTQGQEPILPAVLEFPETHQELFLRHIISELDVNVPHFKLAPVYSLY
LCARYRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFL
HFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQTLNQFLSENIDHDSAAGLV
LTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTADWGKVMTERLQ
LLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALLQQ
EKLPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVRGIPTG
LVDFLNPLQQQGMCRLAAQPTSIGLWTVYMHQFNARSSSAMSNKLPQPELQLIKLHKNSN
GMGLSIVAAKGAGQEKLGIYIKSVVPGGAADADGRLQAGDQLLRVDGQSLIGITQERAAD
YLVRTGPVVSLEVAKQGAIYHGLATLLQQPSPVIQRGNRRMSERDLTRMGGADSTKSLGP
LIANSHSNHSLSLSQHLNNSHNNTIGNCNNSSIINPLAAHLPNSKSVPALHHHTGSGTIS
LANSKSRSTHSLHNNTSGMGGIGGASAGGMLGQPNGSHNNTNGNNNGNEQGFYQNLSVYR
AQNQSQPILNERPPIAAHAAMNAYNGSSPLAPQQQPQQQQQQQSPYQQQQHMQANANIPP
TRPVSAYYHSQQSAQQQQQLQQQQQHSLQQQQQQQFALSSSNGQQQQHQLTLNNRTKSQQ
NFQHTLRMQQMMAPSMPNISNMFHHQQQQQPQLPLQQQQQQPLMSSSQSMQNVNDFTGGY
PNGSLEYRRSQLHDPSTLYEIQQQQQQQQQQQQQQQQASPNFIALPPKPLGSLQSPNKPN
VPPNTAPKPQQDKPPLPPTATHPLFKATQQIAPGMNYVASTLEPPKGSYVASNQANNRPL
HSGSNPWEREEREKDLEMRREHIRQWREQQISDLSQILSRSPMQEEQLKTLILERDFERR
AQELQEQEEQDQEQQYDKENVQELFRLAGGGQVSAIQTPITSYRQTDIKLTEMTDSNSLV
DSVPPQPLAPTTQPLSSNSQQPKSILKHNRYSEAGAGPSGAPSSPSKSQKSASFADERHL
HTEHSIPNLAKDLNQLTMLDKDNNNETLDAVVPPPPPPERNSSYLIMSQQKLRGSTGNAT
SSMGLLKTATSNQAAAAVEIKKASLLSTQTNKNNNLSGSLNNNTMQGSPLSAMELNAAYV
SATGTGTIGGLGTPPPPPPLMQRDNKRVSFHDEENNFVSGNSQQQQLQQQYIIENYGMEH
QDLDTIREDTSYLQHNLDSSMLPSMPATPDAALWNTSVQSTPGVIGAQEVYRDPRTRRLA
EKQQQQQQQRAGDAVPEKLSFKEKMKMFALESGEDNTPKDKLKISRAQRDIDAVH
Download sequence
Identical sequences B3P296
FBpp0129735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]