SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0134497 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0134497
Domain Number 1 Region: 326-420
Classification Level Classification E-value
Superfamily TAFH domain-like 9.16e-33
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 745-794
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000147
Family TBP-associated factors, TAFs 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0134497   Gene: FBgn0108186   Transcript: FBtr0136005
Sequence length 955
Comment type=protein; loc=scaffold_4784:join(18354953..18355306,18356155..18356316,18356511..18356720,18358043..18358603,18358676..18358903,18359116..18360009,18360067..18360240,18360301..18360426,18360524..18360682); ID=FBpp0134497; name=Dere\GG15951-PA; parent=FBgn0108186,FBtr0136005; dbxref=FlyBase:FBpp0134497,FlyBase_Annotation_IDs:GG15951-PA,GB_protein:EDV52205,REFSEQ:XP_001973179,FlyMine:FBpp0134497; MD5=72feda68774a50ae7f4e3bfd28da121c; length=955; release=r1.3; species=Dere;
Sequence
MNTSQTAAGNRITFTSQPLPNGTINIAGNPGAVISTAQLPNTTTIKTIQAGIGGQHQGLQ
QVHHVQQQQQSQQQTQSVGATQTQTLVIKSNHHAVTLPAGLVSSAPAGIVTMTKTINQAG
QPLLNSMLPAGVVVGMRHQAPSQQQQKNVPTNPISRVMINSHMAGVRPQSPSITLSTLNT
GQTPALLVKTDNGFQLLRVGTTTGPPTVTQTITNTSNNNNTTSTTNHPTTTQIRLQTVPA
AASMTNTTATSNIIVNSVASSGYANSSQPPHLTQLNAQAPQLPQITQIQTIPAQQSQQQV
NNVSSAGGTATAVSSTTAATTTQQGNTKEKCRKFLANLIELSTREPKPVEKNVRTLIQEL
VNANVEPEEFCDRLERLLNASPQPCLIGFLKKSLPLLRQALYTKELVIEGIKPPPQHVLG
LAGLSQQLPKIQAQIRPIGPSQTTTIGQTQVRMITPNALGTPRPTIGHTTISKQPPNIRL
PTAPRLVNTGGIRTQIPSLQVPGQANIVQIRGPQHAQLQRTGSVQIRATTRPPNSVPTAN
KLTAVKVGQTQIKAITPSLHPPSLAAISGGPPPTPTLSVLSTLNSASTTSLPIPSLPTVH
LPPEALRAREQMQNSLNHNNNHFEAKLVEIKAPSLHPPHMERINASLTPIGAKTMARPQP
PISKAIGKKKRDAMEMDAKLNTSSGAAASAANSFFQQSSMSSMYGDDDINDVAAMGGVNL
AEESQRILGCTENIGTQIRSCKDEVFLNLPSLQARIRAITSEAGLDEPSQDVAVLISHAC
QERLKNIVEKLAVIAEHRIDVIKLDSRYEPAKDVRGQIKFLEELDKAEQKRHEELEREML
LRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKLKLDGETVS
SGAGSSGGGVLSSSASAPTTLRPRIKRVNLRDMLFYMEQEREFCRSSMLFKTYLK
Download sequence
Identical sequences B3NDS2
FBpp0134497 XP_001973179.1.56816 XP_015014064.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]