SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002886 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002886
Domain Number 1 Region: 665-1091
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 7.85e-114
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000104
Further Details:      
 
Domain Number 2 Region: 66-329
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 6.28e-79
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000193
Further Details:      
 
Domain Number 3 Region: 331-663
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 6.28e-76
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000464
Further Details:      
 
Domain Number 4 Region: 1294-1464
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.32e-61
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000973
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002886   Gene: ENSGALG00000020772   Transcript: ENSGALT00000002890
Sequence length 1765
Comment pep:novel chromosome:Galgal4:8:15439375:15487512:1 gene:ENSGALG00000020772 transcript:ENSGALT00000002890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRPWRCSRPGWMGPWATWSSKWGCWWPCPAGGLEIRDPRGPFQPRPFCDSVISVIYFSI
EPVFCTGKTYLYDYKGLILHGLPGKGLAAAGLKLTCRLEISRVSRSDHLLQIRSPKLEEY
HGFWPRDPFTPSPKLTEMIAACFSQAFKFEYTEGRVGSIYAPENCPILCINLVRGVLNMM
QITIKKTQNVYELQEAGIEGICQARYVIQDDSKNNRATISKSKDLTDCQDSAVQSTGMAY
IRPCPTCPMKVKNMKGTVLFTYKMKYYGSGALMTSAMSEQVYQISPFNEPDGVAAMEARQ
ELVLLDIKSTPIKAPDTQLQNQGSLRYHFPEGLLQMPIPLIRVKNAGVQLAETLRQLGQN
NEEGRTTEASIKFLQMVQLLRVVTLDQIESVWVQFASEQPYRHWFLSAVCAAGATDTFQF
LKQKIHDKNLNIWEAAVALPLAFHSVMPNKKTLEVASTFLTCPQIQKTPMLRVLVYLGYG
SLVNKYCAQPSFCPNELLQPLHDLAAEASSRSHVEDMALALKAIGNAGEPASIKRILKFL
PTFSLAAAALPSRIHTDAVLSLRKIARKDPAKVRGIALQIFMDSTLAPNVRMTACIVLFE
TKPSLPIVVAMASSLLTETSLQVTSFMYSHMKALAVGRIPQLYNLSAACNIAIKLLSPRL
DKLSYRYSKVIHAGGYSHVYKAGAIWRVYLMNSPNTVFPSDIITKVRGYYANTATDIVEM
ALRSQSLTSIIRKQNIPFAEYDTYKTLKELGKKLLGWKELPPEDPLLSAYIKVLGQEIAF
VDIDNGIIQQAMKSLTGSSSWQPAVKRAVEEAQRGVSGQWALPAVVAELRHTVPMVLGLP
LELSVCGAALAQAAAAVDIQMSPPLPDNFRPSKLLETNMDIHADIKPKVYIHMIAMMGTN
TQYLQSGLELHAEFSANTTMKFDARINMKEKNVKIETLPCHQEVELAAVRSEAYAISRNT
EEVDTEKKSPILPKGEMPTISNQRFQSSEIFSRARSWKQRNIPSVMSKEHLQGSEEEHHH
GVGQRSYAHVFCRKLASLGCSACLSLKSRNSPFLRNTCLNNLVGELEAKIVLKPVHTDAD
IEKIQLEIQAGAKAASKIIDATSSGPKEEKKPSLYENIKAKLKKILGIENVFKVANKTRH
HKKWIHSRVKAAVTDLWEEPSATPLSSSSSTDSSAEGEEPGNKRDKDEIWQFGKKYGADS
SSSSSSSSTGSGSSKTCSSSREDSSRDKHCSVDSEYFNQQADLPIYQFWFKPADEQDPRR
KVQNSSISSSSSSSSDEGISTPVSQPMFLGDSKPPVLAAVLRAIRRNEQPTGYQLVLYTD
RQASRLRVQVFVSSITESDRWKLCADASVVNSHKASGTLKWGKDCQDYQVATQIATGQFA
AHPAIQVKLEWSEVPSSVRKTARWFYTYLPGAAYMLGYSQKQQRGPSHQAAMVMALTSPR
TCDVVLKLPELTVYNRAIRLPLPLPSSSDTPTSTLPSSKWNVFYQAAFSIIENLKARCSV
SQNMITTFNGVEFNYSMPANCYHILAQDCSPELKFLVMMKRLGESADLTAISVRLASHEV
DMYVSNGLIQLKINGVQTPTDVPYTSKSGLLISSEKEGLSLKAPEYGVEKLYYDRRKLEI
RVAFWMVGKTCGICGKYDAEKKREYQMPSGYLAKDAVSFAQSWVISEDTCTGACKLQRKF
VKIEKPVAFNKKASKCFSIEPVLRCAEGCSATRTVPVSVGFHCVPSDSTLELEEEQVRLD
QKSEDLVSRVDAHTACSCAQQLCSA
Download sequence
Identical sequences ENSGALP00000002886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]