SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004061 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004061
Domain Number 1 Region: 681-1035
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.1e-95
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000903
Further Details:      
 
Domain Number 2 Region: 498-677
Classification Level Classification E-value
Superfamily ARM repeat 7.48e-56
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000403
Further Details:      
 
Domain Number 3 Region: 106-285
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.46e-49
Family Ras-binding domain, RBD 0.0067
Further Details:      
 
Domain Number 4 Region: 327-477
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-48
Family PLC-like (P variant) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004061   Gene: ENSGALG00000002583   Transcript: ENSGALT00000004070
Sequence length 1046
Comment pep:known chromosome:Galgal4:21:3470173:3492933:1 gene:ENSGALG00000002583 transcript:ENSGALT00000004070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGIYCPMEFWSKGENQNIQVDFLLPTGIYLNLSVPCNASLDTIKQVVWKHAQYEPLYH
MLSDPEAYVFTCINQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSVQDPEVNDFRTKMCQFCEERAAKRQQLSWAAWMEYNFPLQLEPMAKGLGT
GLLHTPIKNIFVNVKFQSGGESFTFQISPNEFPITLMSYAVKKQATVFRHETMENPEDYT
LQVNGKYEYLYGNYPLYQFQYIRSCLHRGLTPHLTMVHSSTIIAMRDEQVNSIANPPKMA
VKPPPLPKKKPNYGSLWSLEQSFYIELVQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVNVCSEPVWKQRLDFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
VNVMLFDYKDQLKTGECCLHMWSSFPDEKGELLNPMGTVQCNPNTESAAALVICFPNVAS
HPVYYPSFEQLLELGRNGEQPRSAPEDPEEKLQLKEILERRNHTELYEHEKDLVWKMRYD
IRDQYPQALAKLLTITKWNKHEDVAQMISLLQTWPELPVLNALELLDFSFPDRYVGSFAI
NSLKKLTDHELFQYLLQLVQVLKYESYLDCELTKFLLDRALSNRKIGHFLFWHLRSEMHV
PAVALRFGLILEAYCRGSTHHMKVLMKQGEALSKMKALNEFVKLSSPKATKPQAKEMMHV
CMKQETYLEALSHLQSPLNPSIILTEVCVDQCTFMDSKMKPLWIVFNNEETGGGGVGIIF
KNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDKTGLIEVVMHSDTIANIQ
LNKSNMAATAAFNKDALLNWLKSKNPGDALEQAIEEFTLSCAGYCVATYVLGIGDRHSDN
IMIRETGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRG
YCEKAYMILRRHGPLFLHLFALMKAAGLPELTCSKDIQYLKDSLALGKTDEEALKHFRLK
FNEALRESWKTKVNWLAHNVSKDNRQ
Download sequence
Identical sequences F1NHX1
ENSGALP00000004061 XP_015152374.1.86415 XP_015152375.1.86415 ENSGALP00000004061 9031.ENSGALP00000004061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]