SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008211 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008211
Domain Number 1 Region: 640-743
Classification Level Classification E-value
Superfamily TAFH domain-like 5.23e-36
Family TAFH domain-like 0.00000463
Further Details:      
 
Domain Number 2 Region: 920-967
Classification Level Classification E-value
Superfamily Histone-fold 5.02e-17
Family TBP-associated factors, TAFs 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008211   Gene: ENSGALG00000005121   Transcript: ENSGALT00000008225
Sequence length 1136
Comment pep:known_by_projection chromosome:Galgal4:20:8020376:8056307:-1 gene:ENSGALG00000005121 transcript:ENSGALT00000008225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLDEVFLNTEVDEKVVSDLVGSLESQLAASGHHHQHHKAQEPLRAAGGLLGNHV
VSGGSGSSSPSPSPGGVVVGGSANAQTESGGGGGKMGLSAPEITKAGTVPCRGQGWGRGA
SPPPPRSPRAVPSPPFALWHPRGSEVGIGPAGPPRAVSPGSEGRSAPPVPALPSRGWCHS
AGRGGSGLGAHPGQGPLPGVRPPPNGKIGTTTVQTLNGSNVVMNSHHTGSAAFSGTPVTA
NPASAPAVAPLVNNGPGSVGKGNTVNAVLPSASNTVIQTSFLNTAVSSASSSSPTVISSQ
PPPSVGSGGPTVTLVRPPIHTAGPTVAAAGAATQNGSNTVINSTISVGSFPAVATATVGS
GVSLQTTLVNSQSGSSVPAAPTTQVIKSESPKTIVQAVSQQQTLATAGQPSTTGGNMIIG
QTMQAGLTNVAPNPGGIPPAAPGTPTGMAKGTANTVAQTLPRTPTATTSGIRATLTPTVL
APRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQSQPQNTMTP
RPATPTSAPPVQISTVQAPGTSIIARQVTPTTIIKQVSQAQTTVQPTTTLQRPPVVQPQI
VLGGTAQTTTLGTATAVQTGTPQRAVQGTTATSTAATETMENVKKCKNFLSTLIKLASSG
KQSSETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPD
SAAFIQQSQQQQPTTQATTALTAVMLSPSVQRAAGKATATVTSTLQQPVISLTQPTQVGV
SKQGQSTPLVIQQPQKAGTLIRPPQVTLTQTPMVALRQPHSRIMLTTPQQIQLNQLQTVP
VVKPTVLPGNKAIATVSTQVAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARI
LATNSELVGTLTRSCKDETFLFSAPLQRRILEIGKKHGITEIHPDVVSYVSHATQQRLQN
LVEKLSETAQQRNISYKDDERYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKS
RSRQEDPEQLRLKQKAKEQMQMQQQELAQMRQRDANLTALAAIGPRKKRKVDSPGSGSGT
EGSGSSAAVPGSSGVGTTRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSGALP00000008211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]