SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010298 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010298
Domain Number 1 Region: 98-229
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.68e-43
Family UAS domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 327-342,373-455
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-25
Family UBX domain 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010298   Gene: ENSGALG00000006385   Transcript: ENSGALT00000010312
Sequence length 456
Comment pep:known_by_projection chromosome:Galgal4:9:4225113:4241351:1 gene:ENSGALG00000006385 transcript:ENSGALT00000010312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEACNNNLEMAVTMFLDGGGIAEEPSTSSAAVSAVRPHTEDEVRAPIPQKQEILVEPEP
LFGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAVDKKLTTLADLFRPPIDLMHKGS
FETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEG
QRYIQFYKLADFPYVSILDPRTGQKLVEWHQLDVTSFLDQVTGFLSEHGQLDGHSTNPPQ
KCSRSESLIDASEDSQLEAAIRASLQETHFDSSQAKQESRSDEESESELFSGSEEFISVC
GSEEEEESENPAKLRKSPHKDLGYKKEESRRPQPEPPARTEPGTTSNHRVLPCIDAGVVE
EPAEKPESMLQGLDVNGPKAQLMLRYPDGKREQISLPEQAKLLALVKHVQSKGYPNERFE
LLTNFPRRKLSHLDYEITLQEAGLCPQETVFVQERN
Download sequence
Identical sequences XP_015132609.1.86415 XP_015132610.1.86415 ENSGALP00000010298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]