SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000011315 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000011315
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 783-1042
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-39
Family YWTD domain 0.0000568
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.02e-28
Family YWTD domain 0.0000979
Further Details:      
 
Domain Number 5 Region: 1173-1208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1135-1171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1094-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 739-784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000367
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000158
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1052-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000943
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000011315   Gene: ENSGALG00000006998   Transcript: ENSGALT00000011329
Sequence length 1453
Comment pep:known chromosome:Galgal4:5:15725349:15821330:1 gene:ENSGALG00000006998 transcript:ENSGALT00000011329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILSALYSPMDI
QVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPFYSCACPTGVQLEDDGRTCKSGAEEVL
LLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDG
SGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAI
VLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGLALDLEEDKLYWGDAKT
DKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKIRASRDIIIDQ
LPDLMGLKATSVTKVFGTNPCAENNGGCSHLCFFTPQETRCACPIGLELLSDMKTCIIPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNPR
SLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLD
TSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGKNRTLIQG
HLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCGCAAHYTLDPNSRNCSSP
TSFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYDPLDKLIYWVDGRQNIIKRA
KDDGTQPFTVMSSPNQSQNPEKQPHDLSIDIYSHTLYWTCEATNSVNVHRLNGESIGMVL
RGDHDKPRAIVVNAERGYMYFTNMQERAPKIERAALDGTEREVLFTTGLIRPVALVIDNK
LGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEK
TNGYKRTRIQGRIAHLTGIHAVEELDMEEFSAHPCSRDNGGCSHICIAKGDGTPRCSCPE
HLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSASQ
FQCEKGQCIDAHLRCNGEIDCQDKSDEVDCDTICLLNQFRCASGQCILLKQQCDSFPDCI
DGSDELMCEKSKPSSDEPQPHSSAIGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNSPF
PHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMGGSSGAPLYDRNHVTGAS
SSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSNIPSTTRSYRPYLIRGTAPPTTP
CSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFH
LYPPPPSPCTDSS
Download sequence
Identical sequences ENSGALP00000011315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]