SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000011316 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000011316
Domain Number 1 Region: 609-864
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 2 Region: 2-257
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-54
Family YWTD domain 0.00000243
Further Details:      
 
Domain Number 3 Region: 308-538
Classification Level Classification E-value
Superfamily YWTD domain 9.29e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 911-1172
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-38
Family YWTD domain 0.0000738
Further Details:      
 
Domain Number 5 Region: 1303-1338
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1265-1301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 564-610
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000223
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1224-1264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 867-912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000399
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 262-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1182-1234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000239
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000011316   Gene: ENSGALG00000006998   Transcript: ENSGALT00000011330
Sequence length 1583
Comment pep:known chromosome:Galgal4:5:15725339:15821530:1 gene:ENSGALG00000006998 transcript:ENSGALT00000011330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYSQGIVFWTDVSEEAIKQTYINQTG
NVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAI
ALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLDEQKLYWADAKL
SFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILS
ALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPFYSCACPTGVQLEDDGRTC
KSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRA
IRRAYLDGSGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISE
NLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGLALDLEEDK
LYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKIRA
SRDIIIDQLPDLMGLKATSVTKVFGTNPCAENNGGCSHLCFFTPQETRCACPIGLELLSD
MKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWTDVSL
KTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQYRQVLV
WKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLTIDYADQ
RLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSG
KNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCGCAAHYTLDP
NSRNCSSPTSFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYDPLDKLIYWVDG
RQNIIKRAKDDGTQATPFTVMSSPNQSQNPEKQPHDLSIDIYSHTLYWTCEATNSVNVHR
LNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERAPKIERAALDGTEREVLFTTGLI
RPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNHLYWIDR
QQQMIERVEKTNGYKRTRIQGRIAHLTGIHAVEELDMEEFSAHPCSRDNGGCSHICIAKG
DGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQSDE
DSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEVDCDTICLLNQFRCASGQCILLK
QQCDSFPDCIDGSDELMCEKSKPSSDEPQPHSSAIGPVIGIILSLFVMGGMYFVCQRVVC
QRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMGGSSGAPL
YDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSNIPSTTRSYRPYL
IRGTAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQYMSAEESCPP
SPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSGALP00000011316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]