SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013101 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013101
Domain Number 1 Region: 731-1092
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.12e-103
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000000000553
Further Details:      
 
Domain Number 2 Region: 529-728
Classification Level Classification E-value
Superfamily ARM repeat 5.18e-62
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00000000799
Further Details:      
 
Domain Number 3 Region: 351-527
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.04e-53
Family PLC-like (P variant) 0.00000016
Further Details:      
 
Domain Number 4 Region: 147-321
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-52
Family Ras-binding domain, RBD 0.000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013101   Gene: ENSGALG00000008081   Transcript: ENSGALT00000013116
Sequence length 1106
Comment pep:known chromosome:Galgal4:1:14213411:14241547:1 gene:ENSGALG00000008081 transcript:ENSGALT00000013116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGDYEQPVVMREENKRRRRRMKPHCTSSNLSSMELISIEFILPTSNKHTKVPEMMLLE
IAGNCTVEQMKAQIWMRAIEMSQTTDFYHTFTPDQFVLQYQKKGQWYEIYDKHQLLQTLD
CILYWKVLQKKVGKIYVVQKQKPSEEVQEFQRQLNDLIGYDVTDVSNVHDDELEFTRRRL
VTPRMIEVACRDPKLYAMHPWTTSKPLPEYLFKKITNNNIFIIIHRGTTSQKIKVSIDDT
PDMILHSFFTKMAKKKSLMDIPEDHSELDFVLRICGRDEYITGDTPIKDFHWIRQCLKNG
EEIHLVLDNPPDPSEDEVQKEEWPLVDDCTGVTGYHEQLTIDGKDHERVFTISLWDCNRK
FRVKIIGIDIPVLPRNTDLTVFVEANIQHGQQLLSQRRTSSKPFTEEVLWNIWLEFDIKI
KDLPKGALLNLQIYCGKAQGLSTKTNLQSHESPNSDSKCKTQLLYYVNLLLIDHRFLLRS
GEYVLHMWKIPGKGEEQGSINADKLTSATNPDKENSMAISIVLDKYCHPIALPKHRITSD
SQGDRTRAEMPNQLRKQLEEIIATDPLNPLSPEDKELLWHFRYESIKHPKAYPKLLSSVK
WGQQEIVAKTYQLLAKKEVWDQSTLDVGLTMQLLDCNFSDENVRAMAVQKLESLEDDDVL
HYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSMHYQQRFAVIL
EAYLRGCGKAMLHDFMKQVQVIELLHKVTMEIKSVSAEKYDVTSQVIAQLRQKLEKLQGS
KLPESFRVPYDPGLRAGPLVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDD
LRQDMLILQILRIMESIWEAESLDLCLLPYGCISTGNKIGMIEIVKDATTIAKIQQSTVG
NTGAFKDEILNQWLKDRCVIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITET
GNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFHKFQDVCVKAY
LALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKHFLDQIEVCRD
KGWTVQFNWFLHLVLGIKQGVEKHSA
Download sequence
Identical sequences E1C093
NP_001186467.1.86415 XP_015131200.1.86415 XP_015131201.1.86415 9031.ENSGALP00000013101 ENSGALP00000013101 ENSGALP00000013101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]