SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013174 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013174
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.73e-36
Family Ubiquitin-related 0.0000197
Further Details:      
 
Domain Number 2 Region: 100-154
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 5.13e-21
Family Ribosomal protein S27a 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013174   Gene: ENSGALG00000008125   Transcript: ENSGALT00000013189
Sequence length 156
Comment pep:known chromosome:Galgal4:3:30836:32970:1 gene:ENSGALG00000008125 transcript:ENSGALT00000013189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSEECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Download sequence
Identical sequences A0A0B8RWD5 A0A151MGG2 A0A1U7RD94 A0A1W7RDR4 A0A218UIG2 A0A2D4G0P2 A0A2D4N2W9 D8KW28 J3S0S4 P79781 T1DL81 U3F6K5 U3K9Q2
NP_001274134.1.86415 NP_990284.1.86415 XP_002199635.1.42559 XP_005042727.1.66865 XP_005144071.1.78019 XP_005299091.1.60341 XP_005422655.1.5688 XP_005525525.1.90289 XP_006021641.1.24877 XP_006274498.1.47583 XP_007070121.1.26238 XP_007432077.1.37977 XP_007432078.1.37977 XP_008491469.1.100939 XP_009091973.1.15306 XP_009474412.1.38621 XP_009900360.1.92783 XP_014122401.1.73095 XP_014750619.1.99236 XP_014821852.1.91963 XP_015282408.1.55130 XP_015478661.1.82291 XP_015686894.1.16292 XP_015686900.1.16292 XP_015712317.1.68032 XP_017677277.1.3805 XP_017933064.1.51550 XP_019404830.1.79039 XP_020664157.1.8467 XP_021247556.1.32913 XP_021393366.1.53032 ENSGALP00000013174 ENSFALP00000011756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]