SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014504 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014504
Domain Number 1 Region: 700-1060
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.14e-88
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000549
Further Details:      
 
Domain Number 2 Region: 519-696
Classification Level Classification E-value
Superfamily ARM repeat 5.18e-63
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000237
Further Details:      
 
Domain Number 3 Region: 106-296
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.79e-48
Family Ras-binding domain, RBD 0.00078
Further Details:      
 
Domain Number 4 Region: 331-472
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.02e-42
Family PLC-like (P variant) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014504   Gene: ENSGALG00000008934   Transcript: ENSGALT00000014520
Sequence length 1068
Comment pep:known chromosome:Galgal4:9:17020759:17042366:-1 gene:ENSGALG00000008934 transcript:ENSGALT00000014520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLLTIKHELFKEARKYPLYQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPICEFDMVKDPEVQDFRRNILNVCKEAVDLRDANAPHSRALYVCPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYTQLPLD
TFTMPSYSRRISTATPYMNGEATAKSLWTINSALRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLSYDMYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINMFDYTDTLVSGKMALNLWAVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SNPVKFPDMTVIEEHANWTISRELGFNYSYAGLSNRIARDNELRESDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVNTPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRAFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNQLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFISPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEMYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Download sequence
Identical sequences O42391
NP_001004410.1.86415 ENSGALP00000014504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]