SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015193 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015193
Domain Number 1 Region: 948-1070
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-26
Family Ankyrin repeat 0.000000241
Further Details:      
 
Domain Number 2 Region: 10-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-23
Family Ras-binding domain, RBD 0.014
Further Details:      
 
Domain Number 3 Region: 1079-1137
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-17
Family SH3-domain 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015193   Gene: ENSGALG00000009339   Transcript: ENSGALT00000015209
Sequence length 1146
Comment pep:known_by_projection chromosome:Galgal4:3:16979342:17021208:1 gene:ENSGALG00000009339 transcript:ENSGALT00000015209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFGSKMMPMFLTVYLSNNEQHFTEVPVTPETTCRDVVELCKEPGESECHLAEVWCGSER
PIADNERMLDILQRFGMQRGEVRFFLRHERSPCRESGTGPRSQDPVLKRNGVKVPSDRRM
ENGVSAPRMDMTLAELQEMASRQQQQIEAQQQMLANKEQRLKFLKQQDQRQQQQAAEQEK
LKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNSLFQQKQRELVLAVSKV
EELTRQLEMLKNGRIDGYHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRN
SEVAVMDKRVNELRERLWKKKAALQQKENVPVSSDGNLPQAVGSAPSRVAAVGPYIQSST
MPRIASRPELLVKPAFSDGTQALQASDGPLKTQTLPNMRAGSSSQAKVPAGSVVPSSKPS
QSAEWSSLNTDNHLSQGSALTSGKGIVSGEGQAEGDAFSRDKEKKVRPFSMFDSVDQSAG
LGTLRKNQSSEDLLREAQAANKNVTKVPPPVPTKPKQINLPYFGQTSHQQLSDPKLDGNL
QKLPLAVASMGSKQKPVAQQPSHPQQMQRISVPPVGPSSSQDQILSSSKQESPPAAAVRP
FTPQPSKETSLPPFRKPQTVAASSIYSMYTQQQTPGKNFQQAVQSALTRAQTRAPHFPSV
YGKPVMAGAGVQNQLPQTENIYSNLQGKPGSPEPEMETTASAHESHETERIPRPLSPTKL
LPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTLAAM
ETISAPSHPSKQTASAVSPESPVEIPNPYASSESEKETVSSMPEPTIAEEAENTPADQSE
AVLPSTALDPVPEAVSDSDESMPPKMEEPSHEAPLPLEVYMEEYPPYPPPPYPSGEPESL
GEDSFNMRPPEVTGQFSLPPGKRTNLRKAGSDRIAHGMRVKFNPLALLLDSSLEGEFDLV
QRIIYEVEDPSMPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASC
NNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVI
YGLWDYEAQNDDELSMKEGDCMTILRREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKP
RQRSLA
Download sequence
Identical sequences ENSGALP00000015193 XP_419394.4.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]