SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000018818 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000018818
Domain Number 1 Region: 19-278
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-54
Family YWTD domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 634-889
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-53
Family YWTD domain 0.00000572
Further Details:      
 
Domain Number 3 Region: 331-566
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-49
Family YWTD domain 0.00000351
Further Details:      
 
Domain Number 4 Region: 940-1199
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-40
Family YWTD domain 0.0000407
Further Details:      
 
Domain Number 5 Region: 1330-1368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 891-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000893
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 1251-1291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 590-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000326
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1292-1328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 281-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000455
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1209-1262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000018818   Gene: ENSGALG00000011558   Transcript: ENSGALT00000018841
Sequence length 1617
Comment pep:known_by_projection chromosome:Galgal4:1:71833436:71943987:-1 gene:ENSGALG00000011558 transcript:ENSGALT00000018841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAYKATIASSFIFLFQAAPLLLYANRRDLRLVDAANGKENATVIVGGLEDAAAVDFVFVK
GLIYWSDVSEEAIKRTEFNKSGSVQNVVISGLLSPDGLACDWLGEKLYWTDSETNRIEVS
NLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTDIY
WPNGLTLDYEEQKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDW
NTHSILACSKYSGEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPT
KPSYQCACPTGVKLLENGKTCKDDVGATELLLLARRTDLRRISLDTPDFTDIVLPLEDIR
HAIAIDFDPLEGYIYWTDDEVRAIRRSFVDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RIVLVNTSLGWPNGLALDYAESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTL
LGDYVYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQIIGLGTNPCAEDNGG
CSHLCLYRPQGLRCACPIGLELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPL
TGVKEASALDFVTDNRYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRASMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLETGLDREIIADDLPHPFGL
TQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNG
HCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSAHQAPTTFLLFSQKNAINRMVIDEQQSP
DIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVISPVPNQNLDMQ
PYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTN
LQERSPKIERAALDGTEREVLFFSGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGAN
RVVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVK
ELNVQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFT
CFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDTQFQCESGQCIDSALRCNGEANCQD
NSDEKNCEVLCLTSQFRCASGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIG
SIIGVILTLFVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGS
LPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATER
SHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTATMAKGY
TSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSGALP00000018818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]