SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019635 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019635
Domain Number 1 Region: 408-795
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.84e-131
Family Ankyrin repeat 0.000000000355
Further Details:      
 
Domain Number 2 Region: 164-426
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-73
Family Ankyrin repeat 0.000003
Further Details:      
 
Domain Number 3 Region: 11-233
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.16e-55
Family Ankyrin repeat 0.0000175
Further Details:      
 
Domain Number 4 Region: 3377-3493
Classification Level Classification E-value
Superfamily DEATH domain 4.37e-27
Family DEATH domain, DD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019635   Gene: ENSGALG00000012044   Transcript: ENSGALT00000019661
Sequence length 3757
Comment pep:known chromosome:Galgal4:4:56333065:56644463:-1 gene:ENSGALG00000012044 transcript:ENSGALT00000019661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQKSDSNASFLRAARAGNLDKVVEYLKSGIDINTCNQNGLNALHLAAKEGHVGLVQELL
ERGSAVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIE
VVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDD
TKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR
NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAP
LLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLL
LDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHL
NIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIA
SRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGASHSMSTKKGF
TPLHVAAKYGSLEVAKLLLQRRASPDSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHA
TAKNGYTPLHIAAKKNQMQIATTLLNYGAETNILTKQGVTPLHLASQGGHTDMVTLLLEK
GSNIHVATKTGLTSLHLAAQEDKVNVAEILTKHGANQDAQTKLGYTPLIVACHYGNIKMV
NFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNAITTNGNTALAIARRL
GYISVVDTLKVVTEEITTTTTTVTEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRP
EDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAMIDD
TVVIPSQQVTTLAKEAERNSYRLSWGPENLDNVALSSSPIHSGFLVSFMVDARGGAMRGC
RHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGKL
HLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVILRSENGDS
WKEHFCEYTEDELNEILNGMDEVLDTPEELEKKRICRIITRDFPQYFAVVSRIKQDSNLI
GPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHTELIKKILGNKATFSPIVTLEP
RRRKFHKPITMTIPVPKASSDGIMNGYGGDTPTLRLLCSITGGTTPAQWEDITGTTPLTF
VNECVSFTTNVSARFWLIDCRQTQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARL
RCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFF
AFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPVYTKESESDQE
QEEEVDMTSEKNDETESTETSILKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTD
PSDKTGSIKVKDLGKATEEEPGEPFEIVERVKEDLEKVNEILRGGSYTKEEHALQKSLSR
QEFVEEEWVIVSDEEIEEARRNAPVEVTEPICVEVRIDKETTEMEKKDMTGMVDYLTEDL
NKYVSLHEVQPQALQEDIVEERFEAVVISRDSEKEGRESPTTETLSPQEQHKPALEIKKP
VRTKLRDKHKQKEGKMHSSEQQPGLMKVSSDESPNEERGLTPAAAPEAKAVSPVIEETPI
GSIKDKVKALQKRVEDEQKIRSKLPVRIQTREGTAEKASKKPVPVKKSVAHKAQPPVSPS
PKTERLEETMSVRELMKAFQSGQDPSKNVSGLFEHKSVKQKQQPPEKETTRRKTISSQSE
TKRVSSHKTDKQKDKQSTVLKAEKEPQPKKGRMQVSTVDTIKKTVGKDQVKQQSSKKTTV
EPPPPVSADESTKDSAVVKGKTSDDQGDTDFQISPDRKTSTDFSDVIKEELEDNDKYQQF
RHLSVTEEGELNLEQVLTSPFNVAFPAEYVKDGFLPALSLQSAAFDGSSESLKHEGVADS
PGSLLDGTPQISSEESYKHEGLAETPETSPESLSFSPKKTDGQIEEAKGTARVHTTAETC
SPKELSPKENEKGITEKQLDAVTETSESHSDRVSEELVPTASEEEADKPKGSSSASITKD
ISRDKESRTTPHLTQSSETHDTALEKEKDITCERRVVVRSPQKLELSLASHDSESFSPVA
DDSVAVSHKDSLEASPVLEDNSSHKTPDSLEPSPMKESPCRDSLESSPVEQKVKAGILGQ
GPLQPILGKGETCPELATVRSRILRDPEGSADDDSLEQTSLMESSGKSPLSPETPSSEEI
SYEITPKTADSQALSNIPKSAVIPEVSEEPEDESESEPKKRFTPEEEMFKMVTKIKTFDE
LEQEAKQKRDYKKDCKQDECSLVADSEVTCETEEPKSKTVEEKDIPTVVMSSAESRKSSS
SSESEPELTQLKKEADSGLLMEPVIRVQPPSPLPSSIDSSSSPEEAGFQPINSKQCSSRI
GAVTAEEDKPAEDDKDEPYILGDSCKASTRKSGICHSDGCVSAETEESKCDSTDDSEMVS
PNAPVTKCEGTLCHSIGDCSQKEVHTESSTLHQDDTNANAIKSTTLLTHTALTAKGMVSE
KIDDGSCGHSNTEFSVLQDGKLTEDDPIEHSDFAKVNADFETPQTEICAEEPLSEYSPLT
TETVELESCVVDAAEIKAPHIVSPYENVSSEHFFTDGGESKVGTGQSLLSREDYSVEETK
DQTGEALLSRGKGSEYESSEEVHMETELKTEDVFQKILPGSSASDSTKLAESALKDIRDE
TEKMISQVVITKTDVDSDTWSDIREDDEAFEARVKEEEQKIFGLMVDRRSQGTTPDTTPA
RTPTEEGTPLSEQNPFLFQEGKLFEMTRSGAIDMTKRNYPDESFHFFQMGQQPQEEVSLC
EEKKEAVEAESSKPESSPDPLSLSESEDLDIQGKDTLNRSPSPPEPCDKSEEMTGEGVGI
GTAKAELKSRIPIKMGISASSKSPKKETAASEAESLFTVETDIVDSSQVPFPISPEQSVV
EDELEFSKVTRFVCSEKDDESPDSSPEEQRSVIEIPTALMERVPSCESKSKIPVRTAAAA
SQSLQQSENENLFTDGFLDSLQCEGKDDQAKPKSKIPVKSAFQRAEQQYTSTDTSVHKLE
SSKALDMTSKLPTKQDSRSKSESDASIPMDPKTKRSIKARSYAEAEAETWERERELKVEL
DSDEATAARPKVFSSRVPVKSRSTTASRTAFSPTKESKEHFFDLYKNSIEFFEEISDEAS
KLVERLTQSEREQELVSDDESSSALEVSVIENVPSIETQQSVPEDIFDTRPIWDESVETQ
IERIPDDNIHDHAEDQQDDRERTEERLAHIADHLGFSWTELARELDFTEEQIHQIRIENP
NSLQDQSHALLKYWLERDGKHATDTSLTQCLTKINRMDIVHLMETSGIDSMQVHGTRTYT
EIEQTIGLDHSEGFSVLQEELYSSRHKPDERHRISKDGDPTEHPPIVSEEDVSVSYSPFQ
DSTPRSEAELSMAELLRQTHKEQVEAEFSGKPQDVIETTSSQHEYFVTTPGTEQRAASDT
SARFSATKEEREKTSPQSPSSAQRGGSPIIQEPEELHLHQDDPSPRRTSLVIVESIDEQP
EKLGSGYEEESLEKADSMPEMPPETVTEEQYTDEHGHTVVKKVTRKIIRRYVSPDGTEKE
DIIMQGTPQKPVTVEEGDGYSKVVKRVVLKSDSEQSE
Download sequence
Identical sequences ENSGALP00000019635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]