SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019695 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019695
Domain Number 1 Region: 645-850
Classification Level Classification E-value
Superfamily Macro domain-like 1.06e-56
Family Macro domain 0.0000909
Further Details:      
 
Domain Number 2 Region: 1485-1670
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.12e-43
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 873-1065
Classification Level Classification E-value
Superfamily Macro domain-like 4.88e-39
Family Macro domain 0.00039
Further Details:      
 
Domain Number 4 Region: 1078-1251
Classification Level Classification E-value
Superfamily Macro domain-like 9.76e-39
Family Macro domain 0.00085
Further Details:      
 
Domain Number 5 Region: 1358-1467
Classification Level Classification E-value
Superfamily WWE domain 5.89e-16
Family WWE domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000019695
Domain Number - Region: 100-172
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0251
Family Canonical RBD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019695   Gene: ENSGALG00000012072   Transcript: ENSGALT00000019721
Sequence length 1671
Comment pep:known chromosome:Galgal4:7:27739668:27755563:-1 gene:ENSGALG00000012072 transcript:ENSGALT00000019721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METAPEPCQVENPEVSLPSPLMVLENVRENVSSYMLTMLVENISDLSEEDGNFSVEMIPE
LQAAVVTFTGNAATADIVKKLNQSERAKKQNLTAHLLELTNCIRAENIPPNTPSDYISIY
FENKKNGGAQVANVFQQHEEGAAIIKFKDHRDVNNVLSKQHSLNGTPISVYPYYASLGTA
LYGKEGPQIKQPDPVTVPLDPYIWRFLQRKNSLIEAIRSDMANCNCEITWPRGNCAEPKV
ILHPSAALSERKRSVAQLVRTWNTVASTTFSYSISKYRVEKLKVSAEVWKAIRTSINHSE
LLMIPFTSKDLLLVVGHKDILKTVVRELNLLIEKVTREIEREKQTTEEIVMLSPGDFAIL
QSIGLEERIRLEFPALQITYDHFQQIINLYGLREEVYKVKGEILVNMQKMTKKSVTLHPF
VFQFLQRIDNETLSQSLFLSKHISAFYELGPDAVLLKGNDDENLLKAEEELKKELDYKSI
ALEDESILQKEEWTALTEENCCNAAVTVIQKEGEIIVAGFSQAVAKAFEELFNFVDENTQ
VQKVIGGKPTVVLMYIKEEKTSVLDDLKNKGVKIDFNKVISLRGPRREVLKGTTLIEQML
SGLHYKRVVINEPGARSYLKERVRFFADSVKNEFNCLIRLEEQPEEYPEEQREHSNVGKC
YTQMTVHGVLIAVYKADLCTHHVDVVVNASNEDLKHIGGLAWALLQAAGPELQAECDGVV
RMSGSLQAGDAVITGAGKLPCKQVIHAVGPRWKEQDAEKCVYLLKKTIKKSLQLAETYNH
RSIAFPSVSGGIFGFPLHKCVNAIVSAIKKTLEEFKRDSSLKEIHLVDITEDNVQAFIKA
LKEVFSDDVPLNNPVHQTSIVHRPTKRIASRSNMNFALVTTEEGLNIMLKKGNIEDASTD
GVVISVGGDLQLEKGQLAKALLSKAGPRLQSDLNDEGLGKSPVEGSVFTTRGYNLSCCYV
FHAVTPGWSQGSESAVKILGKIVTKCLQTAEELSLKSITFPAIGTGILGFPSSVVAKSLF
DKVYEFSSKKKTNSLREVHFLLHPKDVNNIQAFSNEFERRCGNDVDEASKGTAFFGPISN
PARDVYEMRIGSITFQVAAGDITKETGDVIVNISNQAFNLKTGVSKAILEGAGKEVENEC
AELALQPNDGYITTEAGSLPCKKIIHFVARDDIKVPVSKVLQECELQQYTSVTFPAIGTG
QAGRFPDLVADEMMDAITDFARSNSTPSVKTIKIVIFQPHLLNVFHTSMKKRENDGKTKS
KSLISRVTSFLIPEKHPPKEKRKAVLESKVDQAVVQICGESEKEVEKAETWLKSTILKEQ
FQKEINDDAILDFDEAENEELCDLQRRLNIALFLGDNFIRITGFNNDVWFAFSSIQQMIL
RVKTAKYEAIKAELYQNLVEWKYLEKDSYVSFDSMTNMCLESAFVRKQKDVSVIINKKKY
KVDTEGRYATNVEGHRITLIRIDKSADLESTTLPEKWDDMQNQQLKIVELKPDTKDYRQV
KERFLNTSPSLNLKIEKIERVQNPSLWKAYQIKKCQMDDKNGNNSNEKFLFHGTSAESLT
FINNHGFNRSYAGMHAAQYGNGTYFAVNASYSANDTYSKPDANGKKHMYLARVLVGQYSQ
GTQGAITPAAKNVGNTVDLFDSSTDNVNNPSMFIIFNDIQAYPEYLITFTR
Download sequence
Identical sequences E1BQC5
ENSGALP00000019695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]